spacer

EBI Dbfetch

ID   X03945; SV 1; linear; genomic DNA; STD; HUM; 4287 BP.
XX
AC   X03945;
XX
DT   18-NOV-1986 (Rel. 10, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human gene for HLA-B27 antigen
XX
KW   glycoprotein; histocompatibility antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4287
RX   PUBMED; 3912316.
RA   Weiss E.H., Kuon W., Doerner C., Lang M., Riethmueller G.;
RT   "Organization, sequence and expression of the HLA-B27 gene: a molecular
RT   approach to analyze HLA and disease associations";
RL   Immunobiology 170(5):367-380(1985).
XX
DR   MD5; f19999282539ee6fb04a7428da553da1.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
CC   Data kindly reviewed (17-SEP-1986) by G. Riethmuller
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4287
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   TATA_signal     467..472
FT                   /note="TATA like sequence"
FT   prim_transcript <518..>3147
FT   CDS             join(518..590,720..989,1231..1506,2082..2357,2450..2566,
FT                   3009..3041,3149..>3191)
FT                   /product="HLA-B27"
FT                   /db_xref="GOA:P03989"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*27:05:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1HSA"
FT                   /db_xref="PDB:1JGD"
FT                   /db_xref="PDB:1JGE"
FT                   /db_xref="PDB:1K5N"
FT                   /db_xref="PDB:1OF2"
FT                   /db_xref="PDB:1OGT"
FT                   /db_xref="PDB:1ROG"
FT                   /db_xref="PDB:1ROH"
FT                   /db_xref="PDB:1ROI"
FT                   /db_xref="PDB:1ROJ"
FT                   /db_xref="PDB:1ROK"
FT                   /db_xref="PDB:1ROL"
FT                   /db_xref="PDB:1UXS"
FT                   /db_xref="PDB:1UXW"
FT                   /db_xref="PDB:1W0V"
FT                   /db_xref="PDB:1W0W"
FT                   /db_xref="PDB:2A83"
FT                   /db_xref="PDB:2BSR"
FT                   /db_xref="PDB:2BSS"
FT                   /db_xref="PDB:2BST"
FT                   /db_xref="PDB:3B3I"
FT                   /db_xref="PDB:3B6S"
FT                   /db_xref="PDB:3BP4"
FT                   /db_xref="PDB:3BP7"
FT                   /db_xref="PDB:3CZF"
FT                   /db_xref="PDB:3D18"
FT                   /db_xref="PDB:3DTX"
FT                   /db_xref="PDB:3HCV"
FT                   /db_xref="PDB:3LV3"
FT                   /db_xref="PDB:4G8G"
FT                   /db_xref="PDB:4G8I"
FT                   /db_xref="PDB:4G9D"
FT                   /db_xref="PDB:4G9F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03989"
FT                   /protein_id="CAA27578.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASATVPRALMCLSQL"
FT   exon            <518..590
FT                   /number=1
FT   misc_feature    558..559
FT                   /note="pot. alternate splicing signal"
FT   intron          591..719
FT                   /number=1
FT   exon            720..989
FT                   /number=2
FT   misc_feature    736..737
FT                   /note="pot. alternate splicing signal"
FT   misc_feature    830..831
FT                   /note="pot. alternate splicing signal"
FT   intron          990..1230
FT                   /number=2
FT   exon            1231..1506
FT                   /number=3
FT   intron          1507..2081
FT                   /number=3
FT   exon            2082..2357
FT                   /number=4
FT   intron          2358..2449
FT                   /number=4
FT   exon            2450..2566
FT                   /number=5
FT   intron          2567..3008
FT                   /number=5
FT   exon            3009..3041
FT                   /number=6
FT   intron          3042..3147
FT                   /number=6
FT   exon            3148..>3191
FT                   /number=7
FT   misc_feature    3376..3377
FT                   /note="pot. alternate splicing signal"
FT   polyA_signal    3777..3783
XX
SQ   Sequence 4287 BP; 819 A; 1194 C; 1311 G; 963 T; 0 other;
     gagctcactc tctggcatca agttctccgt gatcagtttc cctacacaag atccaagagg        60
     agaggtaagg agtgagaggc agggagtcca gttcagggac agggattcca ggaggagaag       120
     tgaaggggaa gcgggtgggc gccactgggg gtctctccct ggtttccaca gacagatcct       180
     tgtgccggac tcaggcagac agtgtgacaa agaggctggt gtaggagaag agggatcagg       240
     acgaacgtcc aaggccccgg gcgcggtctc agggtctcag gctccgagag ccttgtctgc       300
     attggggagg cgcacagttg gggattcccc actcccacga gtttcacttc ttctcccaac       360
     ctatgtcggg tccttcttcc aggatactcg tgacgcgtcc ccatttccca ctcccattgg       420
     gtgtcgggtg tctagagaag ccaatcagtg tcgccggggt cccagttcta aagtccccac       480
     gcacccaccc ggactcagaa tctcctcaga cgccgagatg cgggtcacgg cgccccgaac       540
     cctcctcctg ctgctctggg gggcagtggc cctgaccgag acctgggctg gtgagtgcgg       600
     ggtcaggcag ggaaatggcc tctgtgggga ggagccaggg gacgcaggcg ggggcgcagg       660
     acccggggag ccgcgccggg aggagggtcg ggcgggtctc agcccctcct cgcccccagg       720
     ctcccactcc atgaggtatt tccacacctc cgtgtcccgg cccggccgcg gggagccccg       780
     cttcatcacc gtgggctacg tggacgacac gctgttcgtg aggttcgaca gcgacgccgc       840
     gagtccgaga gaggagccgc gggcgccgtg gatagagcag gaggggccgg agtattggga       900
     ccgggagaca cagatctgca aggccaaggc acagactgac cgagaggacc tgcggaccct       960
     gctccgctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggc gcaggtcacg      1020
     actccccatc ccccacgtac ggcccgggtc gccccgagtc tccgggtccg agatccgccc      1080
     ccgaggccgc gggacccgcc cagaccctcg accggcgaga gcccaggcgc gtttacccgg      1140
     tttcattttc agttgaggcc aaaatccccg cggttggtcg gggcggggcg gggctcgggg      1200
     ggacggggct gaccgcgggg gcgggtccag ggtctcacac cctccagaat atgtatggct      1260
     gcgacgtggg gccggacggg cgcctcctcc gcgggtacca ccaggacgcc tacgacggca      1320
     aggattacat cgccctgaac gaggacctga gctcctggac cgccgcggac acggcggctc      1380
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg      1440
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc      1500
     gcgcgggtac caggggcagt ggggagcctt ccccatctcc tataggtcgc cggggatggc      1560
     ctcccacgag aagaggagga aaatgggatc agcgctagaa tgtcgccctc ccttgaatgg      1620
     agaatggcat gagttttcct gagtttcctc tgagggcccc ctcttctctc taggacaatt      1680
     aagggatgac gtctctgagg aaatggaggg gaagacagtc cctagaatac tgatcagggg      1740
     tcccctttga cccctgcagc agccttggga accgtgactt ttcctctcag gccttgttct      1800
     ctgcctcaca ctcagtgtgt ttggggctct gattccagca cttctgagtc actttacctc      1860
     cactcagatc aggagcagaa gtccctgttc cccgctcaga gactcgaact ttccaatgaa      1920
     taggagatta tcccaggtgc ctgcgtccag gctggtgtct gggttctgtg ccccttcccc      1980
     accccaggtg tcctgtccat tctcaggctg gtcacatggg tggtcctagg gtgtcccatg      2040
     agagatgcaa agcgcctgaa ttttctgact cttcccatca gaccccccaa agacacacgt      2100
     gacccaccac cccatctctg accatgaggc caccctgagg tgctgggccc tgggcttcta      2160
     ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc aggacactga      2220
     gcttgtggag accagaccag caggagatag aaccttccag aagtgggcag ctgtggtggt      2280
     gccttctgga gaagagcaga gatacacatg ccatgtacag catgaggggc tgccgaagcc      2340
     cctcaccctg agatggggta aggaggggga tgaggggtca tatctcttct cagggaaagc      2400
     aggagccctt cagcaggtca gggcccctca tcttcccttc ctttcccaga gccgtcttcc      2460
     cagtccaccg tccccatcgt gggcattgtt gctggcctgg ctgtcctagc agttgtggtc      2520
     atcggagctg tggtcgctgc tgtgatgtgt aggaggaaga gctcaggtag ggaaggggtg      2580
     aggggtgggg tctgagtttt cttgtcccac tgggggtttc aagccccagg tagaagtgtt      2640
     ccctgcctca ttactgggaa gcagcatcca cacaggggct aacgcagcct gggaccctgt      2700
     gtgccagcac ttactctttt gtgcagcaca tgtgacaatg aaggacggat gtatcacctt      2760
     ggtggttgtg gtgttggggt cctgattcca gcattcatga gtcaggggaa ggtccctgct      2820
     aaggacagac cttaggaggg cagttggtcc aggacccaca cttgctttcc tcgtgtttcc      2880
     tgatcctgcc ttgggtctgt agtcatactt ctggaaattc cttttgggtc caagacgagg      2940
     aggttcctct aagatctcat ggccctgctt cctcccagtc ccctcacagg gaaattttct      3000
     tcccacaggt ggaaaaggag ggagctactc tcaggctgcg tgtaagtgat gggggtggga      3060
     gtgtggagga gctcacccac cccctaattc ctcctgtccc acgtctcctg cgggctctga      3120
     ccaggtcctg tttttgttct actccaggca gcgacagtgc ccagggctct gatgtgtctc      3180
     tcacagcttg aaaaggtgag attcttgggg tctagagtgg gtggggtggc aggtctgggg      3240
     gtgggtgggg cagtggggaa aggcctgggt aatggagatt ctttgattgg gatgtttcgc      3300
     gtgtgtggtg ggctgtttag actgtcatca cttaccatga ctaaccagaa tttgttcatg      3360
     actgttgttt tctgtagcct gagacagctg tcttgtgagg gactgagatg caggatttct      3420
     tcacgcctcc cctttgtgac ttcaagagcc tctggcatct ctttctgcaa aggcacctga      3480
     atgtgtctgc gtccctgtta gcataatgtg aggaggtgga gagaccagcc cacccccgtg      3540
     tccactgtga cccctgttcc catgctgacc tgtgtttcct ccccagtcat ctttcctgtt      3600
     ccagagaggt ggggctggat gtctccatct ctgtctcaac tttatgtgca ctgagctgca      3660
     acttcttact tccctactga aaataagaat ctgaatataa atttgttttc tcaaatattt      3720
     gctatgagag gttgatggat taattaaata agtcaattcc tggaatttga gagagcaaat      3780
     aaagacctga gaaccttcca gaatctgcat gttcgctgtg ctgagtctgt tgcaggtggg      3840
     gtgtggagaa ggctgtgggg ggccgagtgt ggacgggcct gtgcccattt ggtgttgagt      3900
     ccatcatggg ctttatgtgg ttagtcctca gctgggtcac cttcactgct ccattgtcct      3960
     tgtcccttca gtggaaacgt tgtccagcgg gagctgtgac cacagaggct cacacatacg      4020
     ccctgggcgg cccctgcaca cgggggtctc tgtgcattct gttttcagag ccgaattcac      4080
     ctcttgccct gcttctagag ctccttttct gctctgctct cctgccctct ctccctgccc      4140
     tggttctagt gatcttggtg ctgaatccaa tcccaactca tgaatctgta aagcagagtc      4200
     taatttagac ttacatttgt ctgtgaaatt ggacccgtca tcaaggactg ttctttcctg      4260
     aagagagaac ctgattgtgt gctgcag                                          4287
//


spacer
spacer