spacer

EBI Dbfetch

ID   X03665; SV 1; linear; genomic DNA; STD; HUM; 1241 BP.
XX
AC   X03665;
XX
DT   18-NOV-1986 (Rel. 10, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 14)
XX
DE   Human class I MHC gene HLA-B27W exons 1-3 (BRUG cell line)
XX
KW   HLA-B27; MHC class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1241
RX   PUBMED; 3011411.
RA   Seemann G.H.A., Rein R.S., Brown C.S., Ploegh H.L.;
RT   "Gene conversion-like mechanisms may generate polymorphism in human class I
RT   genes";
RL   EMBO J. 5(3):547-552(1986).
XX
DR   MD5; b580ccd06d4af9225436932f333978a0.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
CC   About 380 bp of intron III missing. Sequence continued in X03666.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1241
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="BRUG"
FT                   /db_xref="taxon:9606"
FT   CDS             join(79..151,280..549,793..1068,X03666.1:6..281,
FT                   X03666.1:373..489,X03666.1:930..962,X03666.1:1069..1112)
FT                   /gene="HLA-B27W"
FT                   /db_xref="GOA:P03989"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*27:05:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1HSA"
FT                   /db_xref="PDB:1JGD"
FT                   /db_xref="PDB:1JGE"
FT                   /db_xref="PDB:1K5N"
FT                   /db_xref="PDB:1OF2"
FT                   /db_xref="PDB:1OGT"
FT                   /db_xref="PDB:1ROG"
FT                   /db_xref="PDB:1ROH"
FT                   /db_xref="PDB:1ROI"
FT                   /db_xref="PDB:1ROJ"
FT                   /db_xref="PDB:1ROK"
FT                   /db_xref="PDB:1ROL"
FT                   /db_xref="PDB:1UXS"
FT                   /db_xref="PDB:1UXW"
FT                   /db_xref="PDB:1W0V"
FT                   /db_xref="PDB:1W0W"
FT                   /db_xref="PDB:2A83"
FT                   /db_xref="PDB:2BSR"
FT                   /db_xref="PDB:2BSS"
FT                   /db_xref="PDB:2BST"
FT                   /db_xref="PDB:3B3I"
FT                   /db_xref="PDB:3B6S"
FT                   /db_xref="PDB:3BP4"
FT                   /db_xref="PDB:3BP7"
FT                   /db_xref="PDB:3CZF"
FT                   /db_xref="PDB:3D18"
FT                   /db_xref="PDB:3DTX"
FT                   /db_xref="PDB:3HCV"
FT                   /db_xref="PDB:3LV3"
FT                   /db_xref="PDB:4G8G"
FT                   /db_xref="PDB:4G8I"
FT                   /db_xref="PDB:4G9D"
FT                   /db_xref="PDB:4G9F"
FT                   /protein_id="CAA27302.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   mRNA            join(79..151,280..549,793..1068,X03666.1:6..281,
FT                   X03666.1:373..489,X03666.1:930..962,X03666.1:1069..1116,
FT                   X03666.1:1299..1639)
FT                   /gene="HLA-B27W"
FT   exon            <79..151
FT                   /note="label:ex1"
FT   exon            280..549
FT                   /note="label:ex2"
FT   exon            793..1068
FT                   /note="label:ex3"
XX
SQ   Sequence 1241 BP; 212 A; 400 C; 447 G; 182 T; 0 other;
     gccaatcagt gtcgccgggg tcccagttct aaagtcccca cgcacccacc cggactcaga        60
     atctcctcag acgccgagat gcgggtcacg gcgccccgaa ccctcctcct gctgctctgg       120
     ggggcagtgg ccctgaccga gacctgggct ggtgagtgcg gggtgggcag ggaaatggcc       180
     tctgtgggga ggagcgaggg gaccgcaggc ggggcgcagg aacccgggga gccgcgccgg       240
     gaggagggtc gggcggctct ctgcccctcc tcgccccagg ctcccactcc atgaggtatt       300
     tccacacctc cgtgtcccgg cccggccgcg gggagccccg cttcatcacc gtgggctacg       360
     tggacgacac gctgttcgtg aggttcgaca gcgacgccgc gagtccgaga gaggagccgc       420
     gggcgccgtg gatagagcag gaggggccgg agtattggga ccgggagaca cagatctgca       480
     aggccaaggc acagactgac cgagaggacc tgcggaccct gctccgctac tacaaccaga       540
     gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac gctccccatc ccccacgtac       600
     ggcccgggtc gccccgagtc tccgggtccg agatccgccc ccgaggccgc ggggctcgct       660
     cagccctcgc cggcgagagt cccaagcgcg tttacccggt ttcattttca gttgaggcca       720
     aaatccccgc gggttggtcg gggcggggcg gggctcgggg ggacggggct gaccgcgggg       780
     ggacggggcc agggtctcac accctccaga atatgtatgg ctgcgacgtg gggccggacg       840
     ggcgcctcct ccgcgggtac caccaggacg cctacgacgg caaggattac atcgccctga       900
     acgaggacct gagctcctgg accgccgcgg acacggcggc tcagatcacc cagcgcaagt       960
     gggaggcggc ccgtgtggcg gagcagctga gagcctacct ggagggcgag tgcgtggagt      1020
     ggctccgcag ataccttgag aacgggaagg agacgctgca gcgcgcgggt accaggggca      1080
     gtggggagcc ttccccatct cctataggtc gccggggatg gcctcccacg agaagaggaa      1140
     aatggggtca gcgctgaatg tcgccctccc ttgaatggag aatggcatga gttttcctga      1200
     gtttcctctg agggccccct cttctctcta ggcaattaag g                          1241
//


spacer
spacer