spacer

EBI Dbfetch

ID   X03159; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   X03159;
XX
DT   18-NOV-1986 (Rel. 10, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human gene fragment for HLA-Aw69 class I antigen (exon 4)
XX
KW   class I antigen; glycoprotein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 3877632.
RA   Holmes N.;
RT   "Exon shuffling in vivo can generate novel HLA class I molecules";
RL   EMBO J. 4(11):2849-2854(1985).
XX
DR   MD5; ce81db5abc51887626837e622d4c6bf3.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /strain="IDF, BJ and ZM cell lines"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="human leucocyte antigen A"
FT                   /note="HLA-Aw68"
FT                   /db_xref="GOA:P10316"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*69:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10316"
FT                   /protein_id="CAB56608.1"
FT                   /translation="APKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /number=4
XX
SQ   Sequence 276 BP; 60 A; 83 C; 88 G; 45 T; 0 other;
     acgcccccaa aacgcatatg actcaccacg ctgtctctga ccatgaagcc accctgaggt        60
     gctgggccct gagcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg       120
     accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga accttccaga       180
     agtgggcggc tgtggtggtg ccttctggac aggagcagag atacacctgc catgtgcagc       240
     atgagggttt gcccaagccc ctcaccctga gatggg                                 276
//


spacer
spacer