Dbfetch

ID   X03069; SV 1; linear; mRNA; STD; HUM; 1182 BP.
XX
AC   X03069;
XX
DT   02-JUL-1986 (Rel. 09, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human mRNA for HLA-D class II antigen DR1 beta chain
XX
KW   class II antigen; glycoprotein; major histocompatibility complex;
KW   signal peptide.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1182
RX   PUBMED; 2998758.
RA   Tonnelle C., DeMars R., Long E.O.;
RT   "DO beta: a new beta chain gene in HLA-D with a distinct regulation of
RT   expression";
RL   EMBO J. 4(11):2839-2847(1985).
XX
DR   MD5; 23021a781144408bcb89c5a271fb7e9d.
XX
CC   Data kindly reviewed (08-OCT-1986) by E. Long
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1182
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             63..863
FT                   /note="precursor"
FT                   /db_xref="GOA:P04229"
FT                   /db_xref="H-InvDB:HIT000320962.14"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4C56"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="PDB:4OV5"
FT                   /db_xref="PDB:4X5W"
FT                   /db_xref="PDB:4X5X"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04229"
FT                   /protein_id="CAA26873.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECH
FT                   FFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAV
FT                   DTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   sig_peptide     63..149
FT                   /note="put. signal peptide (aa -29 to -1)"
FT   mat_peptide     150..860
FT                   /note="DR1 beta (aa 1-237)"
FT   misc_feature    162..163
FT                   /note="put. splice site (exon 1/2)"
FT   misc_feature    432..433
FT                   /note="put. splice site (exon 2/3)"
FT   misc_feature    714..715
FT                   /note="put. splice site (exon 3/4)"
FT   misc_feature    825..826
FT                   /note="put. splice site (exon 4/5)"
FT   misc_feature    849..850
FT                   /note="put. splice site (exon 5/6)"
FT   misc_feature    1157..1162
FT                   /note="put. polyadenylation signal"
XX
SQ   Sequence 1182 BP; 250 A; 312 C; 340 G; 280 T; 0 other;
     tagttctccc tgagtgagac ttgcctgctt ctctggcccc tggtcctgtc ctgttctcca        60
     gcatggtgtg tctgaagctc cctggaggct cctgcatgac agcgctgaca gtgacactga       120
     tggtgctgag ctccccactg gctttggctg gggacacccg accacgtttc ttgtggcagc       180
     ttaagtttga atgtcatttc ttcaatggga cggagcgggt gcggttgctg gaaagatgca       240
     tctataacca agaggagtcc gtgcgcttcg acagcgacgt gggggagtac cgggcggtga       300
     cggagctggg gcggcctgat gccgagtact ggaacagcca gaaggacctc ctggagcaga       360
     ggcgggccgc ggtggacacc tactgcagac acaactacgg ggttggtgag agcttcacag       420
     tgcagcggcg agttgagcct aaggtgactg tgtatccttc aaagacccag cccctgcagc       480
     accacaacct cctggtctgc tctgtgagtg gtttctatcc aggcagcatt gaagtcaggt       540
     ggttccggaa cggccaggaa gagaaggctg gggtggtgtc cacaggcctg atccagaatg       600
     gagattggac cttccagacc ctggtgatgc tggaaacagt tcctcggagt ggagaggttt       660
     acacctgcca agtggagcac ccaagtgtga cgagccctct cacagtggaa tggagagcac       720
     ggtctgaatc tgcacagagc aagatgctga gtggagtcgg gggcttcgtg ctgggcctgc       780
     tcttccttgg ggccgggctg ttcatctact tcaggaatca gaaaggacac tctggacttc       840
     agccaacagg attcctgagc tgaaatgcag atgaccacat tcaaggaaga accttctgtc       900
     ccagctttgc agaatgaaaa gctttcctgc ttggcagtta ttcttccaca agagagggct       960
     ttctcaggac ctggttgcta ctggttcggc aactgcagaa aatgtcctcc cttgtggctt      1020
     cctcagctcc tgcccttggc ctgaagtccc agcattgatg acagcgcctc atcttcaact      1080
     tttgtgctcc cctttgccta aaccgtatgg cctcccgtgc atctgtactc accctgtacg      1140
     acaaacacat tacattatta aatgtttctc aaagatggag tt                         1182
//