spacer

EBI Dbfetch

ID   V00711; SV 1; circular; genomic DNA; STD; MUS; 16295 BP.
XX
AC   V00711;
XX
DT   09-JUN-1982 (Rel. 01, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 43)
XX
DE   Mus musculus mitochondrial genome.
XX
KW   12S ribosomal RNA; 16S ribosomal RNA; ATPase; circular; cytochrome; genome;
KW   origin of replication; ribosomal RNA; transfer RNA; transfer RNA-Ala;
KW   transfer RNA-Arg; transfer RNA-Asn; transfer RNA-Asp; transfer RNA-Cys;
KW   transfer RNA-Gln; transfer RNA-Glu; transfer RNA-Gly; transfer RNA-His;
KW   transfer RNA-Ile; transfer RNA-Leu; transfer RNA-Lys; transfer RNA-Met;
KW   transfer RNA-Phe; transfer RNA-Pro; transfer RNA-Ser; transfer RNA-Thr;
KW   transfer RNA-Trp; transfer RNA-Val.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
OG   Mitochondrion
XX
RN   [1]
RP   1-16295
RX   DOI; 10.1016/0092-8674(81)90300-7.
RX   PUBMED; 7332926.
RA   Bibb M.J., van Etten R.A., Wright C.T., Walberg M.W., Clayton D.A.;
RT   "Sequence and gene organization of mouse mitochondrial DNA";
RL   Cell 26(2 Pt 2):167-180(1981).
XX
DR   MD5; fd786a27660fbcafdf3c6e4a7f6472b6.
DR   Ensembl-Gn; ENSMUSG00000064341; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064354; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064356; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064357; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064360; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064363; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064370; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000065947; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082392; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082405; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082408; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082414; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082421; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084013; mus_musculus.
DR   EuropePMC; PMC1199588; 16105171.
DR   EuropePMC; PMC1207285; 8722802.
DR   EuropePMC; PMC1459173; 16722593.
DR   EuropePMC; PMC154334; 12704245.
DR   EuropePMC; PMC2193900; 12782718.
DR   EuropePMC; PMC2214808; 18232733.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC3366991; 22675483.
DR   EuropePMC; PMC43996; 7515499.
DR   RFAM; RF00005; tRNA.
XX
CC   The sequence shown is the sequence of the light (L) strand.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16295
FT                   /organism="Mus musculus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   tRNA            1..68
FT                   /note="tRNA Phe"
FT   rRNA            70..1024
FT                   /note="12S rRNA"
FT   tRNA            1025..1093
FT                   /note="tRNA Val"
FT   rRNA            1094..2675
FT                   /note="16S rRNA"
FT   tRNA            2676..2750
FT                   /note="tRNA Leu"
FT   CDS             2760..3707
FT                   /transl_table=2
FT                   /note="unidentified reading frame 1"
FT                   /db_xref="GOA:P03888"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="MGI:MGI:101787"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03888"
FT                   /protein_id="CAA24080.1"
FT                   /translation="MNILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQP
FT                   FADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNLGILFILA
FT                   TSSLSVYSILWSGWASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMNGSYSLQTLI
FT                   TTQEHMWLLLPAWPMAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFM
FT                   AEYTNIILMNALTTIIFLGPLYYINLPELYSTNFMMEALLLSSTFLWIRASYPRFRYDQ
FT                   LMHLLWKNFLPLTLALCMWHISLPIFTAGVPPYM"
FT   tRNA            3706..3774
FT                   /note="tRNA Ile"
FT   tRNA            complement(3772..3842)
FT                   /note="tRNA Gln"
FT   tRNA            3845..3913
FT                   /note="tRNA Met"
FT   CDS             3914..4951
FT                   /transl_table=2
FT                   /note="unidentified reading frame 2"
FT                   /db_xref="GOA:P03893"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003917"
FT                   /db_xref="InterPro:IPR010933"
FT                   /db_xref="MGI:MGI:102500"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03893"
FT                   /protein_id="CAA24081.1"
FT                   /translation="MNPITLAIIYFTIFLGPVITMSSTNLMLMWVGLEFSLLAIIPMLI
FT                   NKKNPRSTEAATKYFVTQATASMIILLAIVLNYKQLGTWMFQQQTNGLILNMTLMALSM
FT                   KLGLAPFHFWLPEVTQGIPLHMGLILLTWQKIAPLSILIQIYPLLNSTIILMLAITSIF
FT                   MGAWGGLNQTQMRKIMAYSSIAHMGWMLAILPYNPSLTLLNLMIYIILTAPMFMALMLN
FT                   NSMTINSISLLWNKTPAMLTMISLMLLSLGGLPPLTGFLPKWIIITELMKNNCLIMATL
FT                   MAMMALLNLFFYIRLIYSTSLTMFPTNNNSKMMTHQTKTKPNLMFSTLAIMSTMTLPLA
FT                   PQLIT"
FT   tRNA            4950..5016
FT                   /note="tRNA Trp"
FT   tRNA            complement(5018..5086)
FT                   /note="tRNA Ala"
FT   tRNA            complement(5089..5159)
FT                   /note="tRNA Asn"
FT   rep_origin      5160..5191
FT                   /note="region of light strand origin of replication"
FT   tRNA            complement(5192..5257)
FT                   /note="tRNA Cys"
FT   tRNA            complement(5260..5326)
FT                   /note="tRNA Tyr"
FT   CDS             5328..6872
FT                   /transl_table=2
FT                   /note="cytochrome oxidase I"
FT                   /db_xref="GOA:P00397"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="MGI:MGI:102504"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00397"
FT                   /protein_id="CAA24082.1"
FT                   /translation="MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQPG
FT                   ALLGDDQIYNVIVTAHAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWL
FT                   LPPSFLLLLASSMVEAGAGTGWTVYPPLAGNPVHAGASVDLTIFSLHLAGVSSILGAIN
FT                   FITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDP
FT                   AGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWAMMSIG
FT                   FLGFIVWAHHMFTVGLDVDTRACFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLW
FT                   ALGFIFLFTVGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPL
FT                   FSGFTLDDTWAKAHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGS
FT                   FISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK"
FT   tRNA            complement(6869..6939)
FT                   /note="tRNA Ser"
FT   tRNA            6942..7011
FT                   /note="tRNA Asp"
FT   CDS             7013..7696
FT                   /transl_table=2
FT                   /note="cytochrome oxidase II"
FT                   /db_xref="GOA:P00405"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="MGI:MGI:102503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00405"
FT                   /protein_id="CAA24083.1"
FT                   /translation="MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLM
FT                   LTTKLTHTSTMDAQEVETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQW
FT                   YWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSW
FT                   AVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENW
FT                   SASMI"
FT   tRNA            7700..7764
FT                   /note="tRNA Lys"
FT   CDS             7766..7969
FT                   /transl_table=2
FT                   /note="unidentified reading frame A6L"
FT                   /db_xref="GOA:P03930"
FT                   /db_xref="InterPro:IPR001421"
FT                   /db_xref="MGI:MGI:99926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03930"
FT                   /protein_id="CAA24084.1"
FT                   /translation="MPQLDTSTWFITIISSMITLFILFQLKVSSQTFPLAPSPKSLTTM
FT                   KVKTPWELKWTKIYLPHSLPQQ"
FT   CDS             7927..8607
FT                   /transl_table=2
FT                   /note="ATPase 6"
FT                   /db_xref="GOA:P00848"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="MGI:MGI:99927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00848"
FT                   /protein_id="CAA24085.1"
FT                   /translation="MNENLFASFITPTMMGFPIVVAIIMFPSILFPSSKRLINNRLHSF
FT                   QHWLVKLIIKQMMLIHTPKGRTWTLMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSM
FT                   AIPLWAGAVITGFRHKLKSSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTAN
FT                   ITAGHLLMHLIGGATLVLMNISPPTATITFIILLLLTILEFAVALIQAYVFTLLVSLYL
FT                   HDNT"
FT   CDS             8607..9443
FT                   /transl_table=2
FT                   /note="cytochrome oxidase III"
FT                   /db_xref="GOA:P00416"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="MGI:MGI:102502"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00416"
FT                   /protein_id="CAA24090.1"
FT                   /translation="MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTL
FT                   GLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHS
FT                   SLVPTHDLGGCWPPTGISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGKRNHMNQAL
FT                   LITIMLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQ
FT                   LKFHFTSKHHFGFEAAAWYWHFVDVIWLFLYVSIYWWGSYSLSMINMTDFQLVDSE"
FT   tRNA            9391..9458
FT                   /note="tRNA Gly"
FT   CDS             9459..9803
FT                   /transl_table=2
FT                   /note="unidentified reading frame 3"
FT                   /db_xref="GOA:P03899"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="MGI:MGI:102499"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03899"
FT                   /protein_id="CAA24086.1"
FT                   /translation="MNLYTVIFINILLSLTLILVAFWLPQMNLYSEANPYECGFDPTSS
FT                   ARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSLGLAYE
FT                   WTQKGLEWTE"
FT   tRNA            9805..9872
FT                   /note="tRNA Arg"
FT   CDS             9874..10167
FT                   /transl_table=2
FT                   /note="unidentified reading frame 4L"
FT                   /db_xref="GOA:P03903"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="MGI:MGI:102497"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03903"
FT                   /protein_id="CAA24087.1"
FT                   /translation="MPSTFFNLTMAFSLSLLGTLMFRSHLMSTLLCLEGMVLSLFIMTS
FT                   VTSLNSNSMSSMPIPITLVFAACEAAVGLALLVKVSNTYGTDYVQNLNLLQC"
FT   CDS             10161..11585
FT                   /transl_table=2
FT                   /note="unidentified reading frame 4"
FT                   /db_xref="GOA:P03911"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="MGI:MGI:102498"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03911"
FT                   /protein_id="CAA24091.1"
FT                   /translation="MLKIILPSLMLLPLTWLSSPKKTWTNVTSYSFLISLTSLTLLWQT
FT                   DENYKNFSNMFSSDPLSTPLIILTAWLLPLMLMASQNHLKKDNNVLQKLYISMLISLQI
FT                   LLIMTFSATELIMFYILFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGSIPLLIA
FT                   LILIQNHVGTLNLMILSFTTHTLDASWSNNLLWLACMMAFLIKMPLYGVHLWLPKAHVE
FT                   APIAGSMILAAILLKLGSYGMIRISIILDPLTKYMAYPFILLSLWGMIMTSSICLRQTD
FT                   LKSLIAYSSVSHMALVIASIMIQTPWSFMGATMLMIAHGLTSSLLFCLANSNYERIHSR
FT                   TMIMARGLQMVFPLMATWWLMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGIN
FT                   IIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLT
FT                   MCEYSLQKTLDCESDN"
FT   tRNA            11539..11606
FT                   /note="tRNA His"
FT   tRNA            11607..11665
FT                   /note="tRNA Ser"
FT   tRNA            11665..11735
FT                   /note="tRNA Leu"
FT   CDS             11736..13559
FT                   /transl_table=2
FT                   /note="unidentified reading frame 5"
FT                   /db_xref="GOA:P03921"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR010934"
FT                   /db_xref="MGI:MGI:102496"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03921"
FT                   /protein_id="CAA24088.1"
FT                   /translation="MNIFTTSILLIFILLLSPILISMSNLIKHINFPLYTTTSIKFSFI
FT                   ISLLPLLMFFHNNMEYMITTWHWVTMNSMELKMSFKTDFFSILFTSVALFVTWSIMQLS
FT                   SWYMHSDPNINRFIKYLTLFLITMLILTSANNMFQLFIGWEGVGIMSFLLIGWWYGRTD
FT                   ANTAALQAILYNRIGDIGFILAMVWFSLNMNSWELQQIMFSNNNDNLIPLMGLLIAATG
FT                   KSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLVRFHPLTTNNNFILTTMLCLG
FT                   ALTTLFTAICALTQNDIKKIIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAMLF
FT                   MCSGSIIHSLADEQDIRKMGNITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLIIEAI
FT                   NTCNTNAWALLITLIATSMTAMYSMRIIYFVTMTKPRFPPLISINENDPDLMNPIKRLA
FT                   FGSIFAGFVISYNIPPTSIPVLTMPWFLKTTALIISVLGFLIALELNNLTMKLSMNKAN
FT                   PYSSFSTLLGFFPSIIHRITPMKSLNLSLKTSLTLLDLIWLEKTIPKSTSTLHTNMTTL
FT                   TTNQKGLIKLYFMSFLINIILIIILYSINLE"
FT   CDS             complement(13546..14064)
FT                   /transl_table=2
FT                   /note="unidentified reading frame 6"
FT                   /db_xref="GOA:P03925"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="MGI:MGI:102495"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03925"
FT                   /protein_id="CAA24089.1"
FT                   /translation="MNNYIFVLSSLFLVGCLGLALKPSPIYGGLGLIVSGFVGCLMVLG
FT                   FGGSFLGLMVFLIYLGGMLVVFGYTTAMATEEYPETWGSNWLILGFLVLGVIMEVFLIC
FT                   VLNYYDEVGVINLDGLGDWLMYEVDDVGVMLEGGIGVAAMYSCATWMMVVAGWSLFAGI
FT                   FIIIEITRD"
FT   tRNA            complement(14065..14133)
FT                   /note="tRNA Glu"
FT   CDS             14139..15317
FT                   /transl_table=2
FT                   /note="cytochrome B"
FT                   /db_xref="GOA:P00158"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="MGI:MGI:102501"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00158"
FT                   /protein_id="CAA24092.1"
FT                   /translation="MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYY
FT                   GSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGILIMFLILMTLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKLYPCLDSMNITLVL"
FT   tRNA            15283..15349
FT                   /note="tRNA Thr"
FT   tRNA            complement(15350..15416)
FT                   /note="tRNA Pro"
FT   rep_origin      15417..16295
FT                   /note="region of heavy strand origin of replication"
FT   misc_feature    15417..16295
FT                   /note="displacement loop region"
FT   misc_feature    15417..15419
FT                   /note="3' end of displacement loop DNA"
FT   misc_feature    15460..15462
FT                   /note="3' end of displacement loop DNA"
FT   misc_feature    15467..15470
FT                   /note="3' end of displacement loop DNA"
FT   misc_feature    15489..15493
FT                   /note="3' end of displacement loop DNA"
FT   misc_feature    16028..16028
FT                   /note="end of major displacement loop DNA"
FT   misc_feature    16106..16106
FT                   /note="end of longest displacement loop DNA"
XX
SQ   Sequence 16295 BP; 5628 A; 3976 C; 2011 G; 4680 T; 0 other;
     gttaatgtag cttaataaca aagcaaagca ctgaaaatgc ttagatggat aattgtatcc        60
     cataaacaca aaggtttggt cctggcctta taattaatta gaggtaaaat tacacatgca       120
     aacctccata gaccggtgta aaatccctta aacatttact taaaatttaa ggagagggta       180
     tcaagcacat taaaatagct taagacacct tgcctagcca cacccccacg ggactcagca       240
     gtgataaata ttaagcaata aacgaaagtt tgactaagtt atacctctta gggttggtaa       300
     atttcgtgcc agccaccgcg gtcatacgat taacccaaac taattatctt cggcgtaaaa       360
     cgtgtcaact ataaataaat aaatagaatt aaaatccaac ttatatgtga aaattcattg       420
     ttaggaccta aactcaataa cgaaagtaat tctagtcatt tataatacac gacagctaag       480
     acccaaactg ggattagata ccccactatg cttagccata aacctaaata attaaattta       540
     acaaaactat ttgccagaga actactagcc atagcttaaa actcaaagga cttggcggta       600
     ctttatatcc atctagagga gcctgttcta taatcgataa accccgctct acctcaccat       660
     ctcttgctaa ttcagcctat ataccgccat cttcagcaaa ccctaaaaag gtattaaagt       720
     aagcaaaaga atcaaacata aaaacgttag gtcaaggtgt agccaatgaa atgggaagaa       780
     atgggctaca ttttcttata aaagaacatt actataccct ttatgaaact aaaggactaa       840
     ggaggattta gtagtaaatt aagaatagag agcttaattg aattgagcaa tgaagtacgc       900
     acacaccgcc cgtcaccctc ctcaaattaa attaaactta acataattaa tttctagaca       960
     tccgtttatg agaggagata agtcgtaaca aggtaagcat actggaaagt gtgcttggaa      1020
     taatcatagt gtagcttaat attaaagcat ctggcctaca cccagaagat ttcatgacca      1080
     atgaacactc tgaactaatc ctagccctag ccctacacaa atataattat actattatat      1140
     aaatcaaaac atttatccta ctaaaagtat tggagaaaga aattcgtaca tctaggagct      1200
     atagaactag taccgcaagg gaaagatgaa agactaatta aaagtaagaa caagcaaaga      1260
     ttaaaccttg taccttttgc ataatgaact aactagaaaa cttctaacta aaagaattac      1320
     agctagaaac cccgaaacca aacgagctac ctaaaaacaa ttttatgaat caactcgtct      1380
     atgtggcaaa atagtgagaa gatttttagg tagaggtgaa aagcctaacg agcttggtga      1440
     tagctggtta cccaaaaaat gaatttaagt tcaattttaa acttgctaaa aaaacaacaa      1500
     aatcaaaaag taagtttaga ttatagccaa aagagggaca gctcttctgg aacggaaaaa      1560
     acctttaata gtgaataatt aacaaaacag cttttaacca ttgtaggcct aaaagcagcc      1620
     accaataaag aaagcgttca agctcaacat aaaatttcaa ttaattccat aatttacacc      1680
     aacttcctaa acttaaaatt gggttaatct ataactttat agatgcaaca ctgttagtat      1740
     gagtaacaag aattccaatt ctccagacat acgcgtataa caactcggat aaccattgtt      1800
     agttaatcag actataggca ataatcacac tataaataat ccacctataa cttctctgtt      1860
     aacccaacac cggaatgcct aaaggaaaga tccaaaaaga taaaaggaac tcggcaaaca      1920
     agaaccccgc ctgtttacca aaaacatcac ctctagcatt acaagtatta gaggcactgc      1980
     ctgcccagtg actaaagttt aacggccgcg gtatcctgac cgtgcaaagg tagcataatc      2040
     acttgttcct taattaggga ctagcatgaa cggctaaacg agggtccaac tgtctcttat      2100
     ctttaatcag tgaaattgac ctttcagtga agaggctgaa atataataat aagacgagaa      2160
     gaccctatgg agcttaaatt atataactta tctatttaat ttattaaacc taatggccca      2220
     aaaactatag tataagtttg aaatttcggt tggggtgacc tcggagaata aaaaatcctc      2280
     cgaatgatta taacctagac ttacaagtca aagtaaaatc aacatatctt attgacccag      2340
     atatattttg atcaacggac caagttaccc tagggataac agcgcaatcc tatttaagag      2400
     ttcatatcga caattagggt ttacgacctc gatgttggat caggacatcc caatggtgta      2460
     gaagctatta atggttcgtt tgttcaacga ttaaagtcct acgtgatctg agttcagacc      2520
     ggagcaatcc aggtcggttt ctatctattt acgatttctc ccagtacgaa aggacaagag      2580
     aaatagagcc accttacaaa taagcgctct caacttaatt tatgaataaa atctaaataa      2640
     aatatatacg tacaccctct aacctagaga aggttattag ggtggcagag ccaggaaatt      2700
     gcgtaagact taaaaccttg ttcccagagg ttcaaatcct ctccctaata gtgttcttta      2760
     ttaatatcct aacactcctc gtccccattc taatcgccat agccttccta acattagtag      2820
     aacgcaaaat cttagggtac atacaactac gaaaaggccc taacattgtt ggtccatacg      2880
     gcattttaca accatttgca gacgccataa aattatttat aaaagaacca atacgccctt      2940
     taacaacctc tatatcctta tttattattg cacctaccct atcactcaca ctagcattaa      3000
     gtctatgagt tcccctacca ataccacacc cattaattaa tttaaaccta gggattttat      3060
     ttattttagc aacatctagc ctatcagttt actccattct atgatcagga tgagcctcaa      3120
     actccaaata ctcactattc ggagctttac gagccgtagc ccaaacaatt tcatatgaag      3180
     taaccatagc tattatcctt ttatcagttc tattaataaa tggatcctac tctctacaaa      3240
     cacttattac aacccaagaa cacatatgat tacttctgcc agcctgaccc atagccataa      3300
     tatgatttat ctcaacccta gcagaaacaa accgggcccc cttcgacctg acagaaggag      3360
     aatcagaatt agtatcaggg tttaacgtag aatacgcagc cggcccattc gcgttattct      3420
     ttatagcaga gtacactaac attattctaa taaacgccct aacaactatt atcttcctag      3480
     gacccctata ctatatcaat ttaccagaac tctactcaac taacttcata atagaagctc      3540
     tactactatc atcaacattc ctatggatcc gagcatctta tccacgcttc cgttacgatc      3600
     aacttataca tcttctatga aaaaactttc tacccctaac actagcatta tgtatgtgac      3660
     atatttcttt accaattttt acagcgggag taccaccata catatagaaa tatgtctgat      3720
     aaaagaatta ctttgataga gtaaattata gaggttcaag ccctcttatt tctaggacaa      3780
     taggaattga acctacactt aagaattcaa aatttctccg tgcacctaaa caccttatcc      3840
     taatagtaag gtcagctaat taagctatcg ggcccatacc ccgaaaacgt tggtttaaat      3900
     ccttcccgta ctaataaatc ctatcaccct tgccatcatc tacttcacaa tcttcttagg      3960
     tcctgtaatc acaatatcca gcaccaacct aatactaata tgagtaggcc tagaattcag      4020
     cctactagca attatcccca tactaatcaa caaaaaaaac ccacgatcaa ctgaagcagc      4080
     aacaaaatac ttcgtcacac aagcaacagc ctcaataatt atcctcctgg ccatcgtact      4140
     caactataaa caactaggaa catgaatatt tcaacaacaa acaaacggtc ttatccttaa      4200
     cataacatta atagccctat ccataaaact aggcctcgcc ccattccact tctgattacc      4260
     agaagtaact caagggatcc cactgcacat aggacttatt cttcttacat gacaaaaaat      4320
     tgctccccta tcaattttaa ttcaaattta cccgctactc aactctacta tcattttaat      4380
     actagcaatt acttctattt tcataggggc atgaggagga cttaaccaaa cacaaatacg      4440
     aaaaattata gcctattcat caattgccca cataggatga atattagcaa ttcttcctta      4500
     caacccatcc ctcactctac tcaacctcat aatctatatt attcttacag cccctatatt      4560
     catagcactt atactaaata actctataac catcaactca atctcacttc tatgaaataa      4620
     aactccagca atactaacta taatctcact gatattacta tccctaggag gccttccacc      4680
     actaacagga ttcttaccaa aatgaattat catcacagaa cttataaaaa acaactgtct      4740
     aattatagca acactcatag caataatagc tctactaaac ctattctttt atattcgcct      4800
     aatttattcc acttcactaa caatatttcc aaccaacaat aactcaaaaa taataactca      4860
     ccaaacaaaa actaaaccca acctaatatt ttccacccta gctatcataa gcacaataac      4920
     cctaccccta gccccccaac taattaccta gaagtttagg atatactagt ccgcgagcct      4980
     tcaaagccct aagaaaacac acaagtttaa cttctgataa ggactgtaag acttcatcct      5040
     acatctattg aatgcaaatc aattgcttta attaagctaa gacctcaact agattggcag      5100
     gaattaaacc tacgaaaatt tagttaacag ctaaataccc tattactggc ttcaatctac      5160
     ttctaccgcc gaaaaaaaaa aatggcggta gaagtcttag tagagatttc tctacacctt      5220
     cgaatttgca attcgacatg aatatcacct taagacctct ggtaaaaaga ggatttaaac      5280
     ctctgtgttt agatttacag tctaatgctt actcagccat tttacctatg ttcattaatc      5340
     gttgattatt ctcaaccaat cacaaagata tcggaaccct ctatctacta ttcggagcct      5400
     gagcgggaat agtgggtact gcactaagta ttttaattcg agcagaatta ggtcaaccag      5460
     gtgcactttt aggagatgac caaatttaca atgttatcgt aactgcccat gcttttgtta      5520
     taattttctt catagtaata ccaataataa ttggaggctt tggaaactga cttgtcccac      5580
     taataatcgg agccccagat atagcattcc cacgaataaa taatataagt ttttgactcc      5640
     taccaccatc atttctcctt ctcctagcat catcaatagt agaagcagga gcaggaacag      5700
     gatgaacagt ctacccacct ctagccggaa atccagtcca tgcaggagca tcagtagacc      5760
     taacaatttt ctcccttcat ttagctggag tgtcatctat tttaggtgca attaatttta      5820
     ttaccactat tatcaacatg aaacccccag ccataacaca gtatcaaact ccactatttg      5880
     tctgatccgt acttattaca gccgtactgc tcctattatc actaccagtg ctagccgcag      5940
     gcattactat actactaaca gaccgcaacc taaacacaac tttctttgat cccgctggag      6000
     gaggggaccc aattctctac cagcatctgt tctgattctt tgggcaccca gaagtttata      6060
     ttcttatcct cccaggattt ggaattattt cacatgtagt tacttactac tccggaaaaa      6120
     aagaaccttt cggctatata ggaatagtat gagcaataat gtctattggc tttctaggct      6180
     ttattgtatg agcccaccac atattcacag taggattaga tgtagacaca cgagcttgct      6240
     ttacatcagc cactataatt atcgcaattc ctaccggtgt caaagtattt agctgacttg      6300
     caaccctaca cggaggtaat attaaatgat ctccagctat actatgagcc ttaggcttta      6360
     ttttcttatt tacagttggt ggtctaaccg gaattgtttt atccaactca tcccttgaca      6420
     tcgtgcttca cgatacatac tatgtagtag cccatttcca ctatgttcta tcaatgggag      6480
     cagtgtttgc tatcatagca ggatttgttc actgattccc attattttca ggcttcaccc      6540
     tagatgacac atgagcaaaa gcccacttcg ccatcatatt cgtaggagta aacataacat      6600
     tcttccctca acatttcctg ggcctttcag gaataccacg acgctactca gactacccag      6660
     atgcttacac cacatgaaac actgtctctt ctataggatc atttatttca ctaacagctg      6720
     ttctcatcat gatctttata atttgagagg cctttgcttc aaaacgagaa gtaatatcag      6780
     tatcgtatgc ttcaacaaat ttagaatgac ttcatggctg ccctccacca tatcacacat      6840
     tcgaggaacc aacctatgta aaagtaaaat aagaaaggaa ggaatcgaac cccctaaaat      6900
     tggtttcaag ccaatctcat atcctatatg tctttctcaa taagatatta gtaaaatcaa      6960
     ttacataact ttgtcaaagt taaattatag atcaataatc tatatatctt atatggccta      7020
     cccattccaa cttggtctac aagacgccac atcccctatt atagaagagc taataaattt      7080
     ccatgatcac acactaataa ttgttttcct aattagctcc ttagtcctct atatcatctc      7140
     gctaatatta acaacaaaac taacacatac aagcacaata gatgcacaag aagttgaaac      7200
     catttgaact attctaccag ctgtaatcct tatcataatt gctctcccct ctctacgcat      7260
     tctatatata atagacgaaa tcaacaaccc cgtattaacc gttaaaacca tagggcacca      7320
     atgatactga agctacgaat atactgacta tgaagaccta tgctttgatt catatataat      7380
     cccaacaaac gacctaaaac ctggtgaact acgactgcta gaagttgata accgagtcgt      7440
     tctgccaata gaacttccaa tccgtatatt aatttcatct gaagacgtcc tccactcatg      7500
     agcagtcccc tccctaggac ttaaaactga tgccatccca ggccgactaa atcaagcaac      7560
     agtaacatca aaccgaccag ggttattcta tggccaatgc tctgaaattt gtggatctaa      7620
     ccatagcttt atgcccattg tcctagaaat ggttccacta aaatatttcg aaaactgatc      7680
     tgcttcaata atttaatttc actatgaagc taagagcgtt aaccttttaa gttaaagtta      7740
     gagaccttaa aatctccata gtgatatgcc acaactagat acatcaacat gatttatcac      7800
     aattatctca tcaataatta ccctatttat cttatttcaa ctaaaagtct catcacaaac      7860
     attcccactg gcaccttcac caaaatcact aacaaccata aaagtaaaaa ccccttgaga      7920
     attaaaatga acgaaaatct atttgcctca ttcattaccc caacaataat aggattccca      7980
     atcgttgtag ccatcattat atttccttca atcctattcc catcctcaaa acgcctaatc      8040
     aacaaccgtc tccattcttt ccaacactga ctagttaaac ttattatcaa acaaataatg      8100
     ctaatccaca caccaaaagg acgaacatga accctaataa ttgtttccct aatcatattt      8160
     attggatcaa caaatctcct aggcctttta ccacatacat ttacacctac tacccaacta      8220
     tccataaatc taagtatagc cattccacta tgagctggag ccgtaattac aggcttccga      8280
     cacaaactaa aaagctcact tgcccacttc cttccacaag gaactccaat ttcactaatt      8340
     ccaatactta ttattattga aacaattagc ctatttattc aaccaatggc attagcagtc      8400
     cggcttacag ctaacattac tgcaggacac ttattaatac acctaatcgg aggagctact      8460
     ctagtattaa taaatattag cccaccaaca gctaccatta catttattat tttacttcta      8520
     ctcacaattc tagaatttgc agtagcatta attcaagcct acgtattcac cctcctagta      8580
     agcctatatc tacatgataa tacataatga cccaccaaac tcatgcatat cacatagtta      8640
     atccaagtcc atgaccatta actggagcct tttcagccct ccttctaaca tcaggtctag      8700
     taatatgatt tcactataat tcaattacac tattaaccct tggcctactc accaatatcc      8760
     tcacaatata tcaatgatga cgagacgtaa ttcgtgaagg aacctaccaa ggccaccaca      8820
     ctcctattgt acaaaaagga ctacgatatg gtataattct attcatcgtc tcggaagtat      8880
     ttttctttgc aggattcttc tgagcgttct atcattctag cctcgtacca acacatgatc      8940
     taggaggctg ctgacctcca acaggaattt caccacttaa ccctctagaa gtcccactac      9000
     ttaatacttc agtacttcta gcatcaggtg tttcaattac atgagctcat catagcctta      9060
     tagaaggtaa acgaaaccac ataaatcaag ccctactaat taccattata ctaggacttt      9120
     acttcaccat cctccaagct tcagaatact ttgaaacatc attctccatt tcagatggta      9180
     tctatggttc tacattcttc atggctactg gattccatgg actccatgta attattggat      9240
     caacattcct tattgtttgc ctactacgac aactaaaatt tcacttcaca tcaaaacatc      9300
     acttcggatt tgaagccgca gcatgatact gacattttgt agacgtaatc tgacttttcc      9360
     tatacgtctc catttattga tgaggatctt actcccttag tataattaat ataactgact      9420
     tccaattagt agattctgaa taaacccaga agagagtaat caacctgtac actgttatct      9480
     tcattaatat tttattatcc ctaacgctaa ttctagttgc attctgactc ccccaaataa      9540
     atctgtactc agaagcaaat ccatatgaat gcggattcga ccctacaagc tctgcacgtc      9600
     taccattctc aataaaattt ttcttggtag caattacatt tctattattt gacctagaaa      9660
     ttgctcttct acttccacta ccatgagcaa ttcaaacaat taaaacctct actataataa      9720
     ttatagcctt tattctagtc acaattctat ctctaggcct agcatatgaa tgaacacaaa      9780
     aaggattaga atgaacagag taaatggtaa ttagtttaaa aaaaattaat gatttcgact      9840
     cattagatta tgatgctgtt cataattacc aatatgccat ctaccttctt caacctcacc      9900
     atagccttct cactatcact tctagggaca cttatatttc gctctcacct aatatccaca      9960
     ttactatgcc tggaaggcat agtattatcc ttatttatta taacttcagt aacttcccta     10020
     aactccaact ccataagctc cataccaatc cccatcacct tagttttcgc agcctgcgaa     10080
     gcagctgtag gactagccct actagtaaaa gtttcaaaca cgtacggaac agattacgtc     10140
     caaaatctca acctactaca atgctaaaaa ttattcttcc ctcactaatg ctactaccac     10200
     taacctgact atcaagccct aaaaaaacct gaacaaacgt aacctcatat agttttctaa     10260
     ttagtttaac cagcctaaca cttctatgac aaaccgacga aaattataaa aacttttcaa     10320
     atatattctc ctcagacccc ctatccacac cattaattat tttaacagcc tgattactgc     10380
     cactaatatt aatagctagc caaaaccacc taaaaaaaga taataacgta ctacaaaaac     10440
     tctacatctc aatactaatc agcttacaaa ttctcctaat cataaccttt tcagcaactg     10500
     aactaattat attttatatt ttatttgaag caaccttaat cccaacactt attattatta     10560
     cccgatgagg gaaccaaact gaacgcctaa acgcagggat ttatttccta ttttataccc     10620
     taatcggttc tattccactg ctaattgccc tcatcttaat ccaaaaccat gtaggaaccc     10680
     taaacctcat aattttatca ttcacaacac acaccttaga cgcttcatga tctaacaact     10740
     tactatggtt ggcatgcata atagcatttc ttattaaaat accattatat ggagttcacc     10800
     tatgactacc aaaagcccat gttgaagctc caattgctgg gtcaataatt ctagcagcta     10860
     ttcttctaaa attaggtagt tacggaataa ttcgcatctc cattattcta gacccactaa     10920
     caaaatatat agcatacccc ttcatccttc tctccctatg aggaataatt ataactagct     10980
     caatctgctt acgccaaaca gatttaaaat cactaatcgc ctactcctca gttagccaca     11040
     tagcacttgt tattgcatca atcataatcc aaactccatg aagcttcata ggagcaacaa     11100
     tactaataat cgcacatggc ctcacatcat cactcctatt ctgcctagca aactccaact     11160
     acgaacggat ccacagccgt actataatca tggcccgagg acttcaaatg gtcttcccac     11220
     ttatagccac atgatgactg atagcaagtc tagctaatct agctctaccc ccttcaatca     11280
     atctaatagg agaattattc attaccatat cattattttc ttgatcaaac tttaccatta     11340
     ttcttatagg aattaacatt attattacag gtatatactc aatatacata attattacca     11400
     cccaacgcgg caaactaacc aaccatataa ttaacctcca accctcacac acacgagaac     11460
     taacactaat agcccttcac ataattccac ttattcttct aactaccagt ccaaaactaa     11520
     ttacaggcct gacaatatgt gaatatagtt tacaaaaaac attagactgt gaatctgaca     11580
     acaggaaata aacctcctta ttcaccaaga aagattgcaa gaactgctaa ttcatgcttc     11640
     catgtttaaa aacatggctt tcttactttt ataggataat agtaatccat tggtcttagg     11700
     aaccaaaaac cttggtgcaa atccaaataa aagtaatcaa tattttcaca acctcaatct     11760
     tattaatctt cattcttcta ctatccccaa tcctaatttc aatatcaaac ctaattaaac     11820
     acatcaactt cccactgtac accaccacat caatcaaatt ctccttcatt attagcctct     11880
     tacccctatt aatatttttc cacaataata tagaatatat aattacaacc tggcactgag     11940
     tcaccataaa ttcaatagaa cttaaaataa gcttcaaaac tgactttttc tctatcctgt     12000
     ttacatctgt agcccttttt gtcacatgat caattataca actctcttca tgatatatac     12060
     actcagaccc aaacatcaat cgattcatta aatatcttac actattcctg attaccatgc     12120
     ttatcctcac ctcagccaac aacatatttc aacttttcat tggctgagaa ggggtgggaa     12180
     ttatatcttt cctactaatt ggatgatggt acggacgaac agacgcaaat actgcagccc     12240
     tacaagcaat cctctataac cgcatcggag acatcggatt cattttagct atagtttgat     12300
     tttccctaaa cataaactca tgagaacttc aacagattat attctccaac aacaacgaca     12360
     atctaattcc acttataggc ctattaatcg cagctacagg aaaatcagca caatttggcc     12420
     tccacccatg actaccatca gcaatagaag gccctacacc agtttcagca ctactacact     12480
     caagtacaat agtagttgca ggaattttcc tactggtccg attccacccc ctcacgacta     12540
     ataataactt tattttaaca actatacttt gcctcggagc cctaaccaca ttatttacag     12600
     ctatttgtgc tctcacccaa aacgacatca aaaaaatcat tgccttctct acatcaagcc     12660
     aactaggcct gataatagtg acgctaggaa taaaccaacc acacctagca ttcctacaca     12720
     tctgtaccca cgcattcttc aaagctatac tctttatatg ctctggctca atcattcata     12780
     gcctggcaga cgaacaagac atccgaaaaa taggaaacat cacaaaaatc ataccattca     12840
     catcatcatg cctagtaatc ggaagcctcg ccctcacagg aataccattc ctaacagggt     12900
     tctactcaaa agacctaatt attgaagcaa ttaatacctg caacaccaac gcctgagccc     12960
     tactaattac actaatcgcc acttctataa cagctatgta cagcatacga atcatttact     13020
     tcgtaacaat aacaaaaccg cgttttcccc ccctaatctc cattaacgaa aatgacccag     13080
     acctcataaa cccaatcaaa cgcctagcat tcggaagcat ctttgcagga tttgtcatct     13140
     catataatat tccaccaacc agcattccag tcctcacaat accatgattt ttaaaaacca     13200
     cagccctaat tatttcagta ttaggattcc taatcgcact agaactaaac aacctaacca     13260
     taaaactatc aataaataaa gcaaatccat attcatcctt ctcaacttta ctggggtttt     13320
     tcccatctat tattcaccgc attacaccca taaaatctct caacctaagc ctaaaaacat     13380
     ccctaactct cctagacttg atctggttag aaaaaaccat cccaaaatcc acctcaactc     13440
     ttcacacaaa cataaccact ttaacaacca accaaaaagg cttaattaaa ttgtacttta     13500
     tatcattcct aattaacatc atcttaatta ttatcttata ctcaattaat ctcgagtaat     13560
     ctcgataata ataaaaatac ccgcaaacaa agatcaccca gctactacca tcattcaagt     13620
     agcacaacta tatattgccg ctaccccaat ccctccttcc aacataactc caacatcatc     13680
     aacctcatac atcaaccaat ctcccaaacc atcaagatta attactccaa cttcatcata     13740
     ataattaagc acacaaatta aaaaaacctc tataatcacc cccaatacta aaaaacccaa     13800
     aattaatcag ttagatcccc aagtctctgg atattcctca gtagctatag cagtcgtata     13860
     tccaaacaca accaacatcc cccctaaata aattaaaaaa actattaaac ctaaaaacga     13920
     tccaccaaac cctaaaacca ttaaacaacc aacaaaccca ctaacaatta aacctaaacc     13980
     tccataaata ggtgaaggct ttaatgctaa cccaagacaa ccaaccaaaa ataatgaact     14040
     taaaacaaaa atataattat tcattatttc tacacagcat tcaactgcga ccaatgacat     14100
     gaaaaatcat cgttgtaatt caactacaga aacacctaat gacaaacata cgaaaaacac     14160
     acccattatt taaaattatt aaccactcat tcattgacct acctgcccca tccaacattt     14220
     catcatgatg aaactttggg tcccttctag gagtctgcct aatagtccaa atcattacag     14280
     gtcttttctt agccatacac tacacatcag atacaataac agccttttca tcagtaacac     14340
     acatttgtcg agacgtaaat tacgggtgac taatccgata tatacacgca aacggagcct     14400
     caatattttt tatttgctta ttccttcatg tcggacgagg cttatattat ggatcatata     14460
     catttataga aacctgaaac attggagtac ttctactgtt cgcagtcata gccacagcat     14520
     ttataggcta cgtccttcca tgaggacaaa tatcattctg aggtgccaca gttattacaa     14580
     acctcctatc agccatccca tatattggaa caaccctagt cgaatgaatt tgagggggct     14640
     tctcagtaga caaagccacc ttgacccgat tcttcgcttt ccacttcatc ttaccattta     14700
     ttatcgcggc cctagcaatc gttcacctcc tcttcctcca cgaaacagga tcaaacaacc     14760
     caacaggatt aaactcagat gcagataaaa ttccatttca cccctactat acaatcaaag     14820
     atatcctagg tatcctaatc atattcttaa ttctcataac cctagtatta tttttcccag     14880
     acatactagg agacccagac aactacatac cagctaatcc actaaacacc ccaccccata     14940
     ttaaacccga atgatatttc ctatttgcat acgccattct acgctcaatc cccaataaac     15000
     taggaggtgt cctagcctta atcttatcta tcctaatttt agccctaata cctttccttc     15060
     atacctcaaa gcaacgaagc ctaatattcc gcccaatcac acaaattttg tactgaatcc     15120
     tagtagccaa cctacttatc ttaacctgaa ttgggggcca accagtagaa cacccattta     15180
     ttatcattgg ccaactagcc tccatctcat acttctcaat catcttaatt cttataccaa     15240
     tctcaggaat tatcgaagac aaaatactaa aattatatcc atgtcttgat agtataaaca     15300
     ttactctggt cttgtaaacc tgaaatgaag atcttctctt ctcaagacat caagaagaag     15360
     gagctactcc ccaccaccag cacccaaagc tggtattcta attaaactac ttcttgagta     15420
     cataaattta catagtacaa cagtacattt atgtatatcg tacattaaac tattttcccc     15480
     aagcatataa gctagtacat taaatcaatg gttcaggtca taaaataatc atcaacataa     15540
     atcaatatat ataccatgaa tattatctta aacacattaa actaatgtta taaggacata     15600
     tctgtgttat ctgacataca ccatacagtc ataaactctt ctcttccata tgactatccc     15660
     cttccccatt tggtctatta atctaccatc ctccgtgaaa ccaacaaccc gcccaccaat     15720
     gcccctcttc tcgctccggg cccattaaac ttgggggtag ctaaactgaa actttatcag     15780
     acatctggtt cttacttcag ggccatcaaa tgcgttatcg cctcatacgt tccccttaaa     15840
     taagacatct cgatggtatc gggtctaatc agcccatgac caacataact gtggtgtcat     15900
     gcatttggta tctttttatt ttggcctact ttcatcaaca tagccgtcaa ggcatgaaag     15960
     gacagcacac agtctagacg cacctacggt gaagaatcat tagtccgcaa aacccaatca     16020
     cctaaggcta attattcatg cttgttagac ataaatgcta ctcaatacca aattttaact     16080
     ctccaaaccc cccaccccct cctcttaatg ccaaacccaa aaaacactaa gaacttgaaa     16140
     gacatataat attaactatc aaaccctatg tcctgatcaa ttctagtagt tcccaaaata     16200
     tgacttatat tttagtactt gtaaaaattt tacaaaatca atgttccgtg aaccaaaact     16260
     ctaatcatac tctattacgc aataaacatt aacaa                                16295
//


spacer
spacer