Dbfetch

ID   U96926; SV 1; linear; genomic DNA; STD; HUM; 405 BP.
XX
AC   U96926;
XX
DT   01-OCT-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens class II antigen HLA-DRB1 (allele DBR1*0818) gene, exon 2 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-405
RA   Woelpl A., Erne G., Goldmann S., Schwarz K.;
RT   "Nucleotide sequence of a novel HLA-DRB1 allele, DRB1*08var";
RL   Unpublished.
XX
RN   [2]
RP   1-405
RA   Woelpl A., Erne G., Goldmann S., Schwarz K.;
RT   ;
RL   Submitted (09-APR-1997) to the INSDC.
RL   Transfusion Medicine, University of Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; 7bbf19320e57bade22dec8815c09c4b6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..405
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..53
FT                   /gene="HLA-DBR1"
FT                   /number=1
FT   exon            54..323
FT                   /gene="HLA-DBR1"
FT                   /number=2
FT   CDS             <54..>323
FT                   /codon_start=3
FT                   /gene="HLA-DBR1"
FT                   /product="class II antigen HLA-DRB1"
FT                   /db_xref="GOA:O19804"
FT                   /db_xref="IMGT/HLA:DRB1*08:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19804"
FT                   /protein_id="AAB71649.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   intron          324..>405
FT                   /number=2
XX
SQ   Sequence 405 BP; 71 A; 93 C; 152 G; 89 T; 0 other;
     cagtgttttt ttcggaggcc gcccctgtga ccggatcgtt cgtgtcccca cagcacgttt        60
     cttggagtac tctacgggtg agtgttattt cttcaatggg acggagcggg tgcggttcct       120
     ggacagatac ttctataacc aagaggagta cgtgcgcttc gacagcgacg tgggggagta       180
     ccgggcggtg acggagctgg ggcggcctag cgccgagtac tggaacagcc agaaggacat       240
     cctggaagac aggcgggccg cggtggacac ctactgcaga cacaactacg gggttggtga       300
     gagcttcaca gtgcagcggc gaggtgagcg cggcgcgggg cggggcctga gtccctgtga       360
     gctgggaatc tgagtgtgtg tgtgtgtgtg tgtgtgtgtg tctgt                       405
//