spacer

EBI Dbfetch

ID   U95734; SV 1; linear; mRNA; STD; HUM; 954 BP.
XX
AC   U95734;
XX
DT   01-OCT-1997 (Rel. 52, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Human MHC class I chain-related protein (MICB) mRNA, allele 7, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-954
RX   DOI; 10.1007/s002510050299.
RX   PUBMED; 9271635.
RA   Pellet P., Renaud M., Fodil N., Laloux L., Inoko H., Hauptmann G.,
RA   Debre P., Bahram S., Theodorou I.;
RT   "Allelic repertoire of the human MICB gene";
RL   Immunogenetics 46(5):434-436(1997).
XX
RN   [2]
RP   1-954
RA   Pellet P., Bahram S., Theodorou I.;
RT   ;
RL   Submitted (25-MAR-1997) to the INSDC.
RL   Laboratoire Central d'Immunologie, Hopital Pitie Salpetriere, Batiment
RL   CERVI 83 Bd de l'Hopital, Paris 75013, France
XX
DR   MD5; b55ff91ba39d9e3fdf3674227d00b073.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   H-InvDB; HIT000222786_03.4.
DR   IMGT/LIGM; U95734.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..954
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>954
FT                   /codon_start=1
FT                   /gene="MICB"
FT                   /product="MHC class I chain-related protein"
FT                   /note="Allele: 7; coding sequence is from the second to
FT                   fifth exon"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="H-InvDB:HIT000222786_02.4"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*004:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="AAB71647.1"
FT                   /translation="EPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKP
FT                   QGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSST
FT                   RGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQAD
FT                   CLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVS
FT                   LSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQ
FT                   SQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
XX
SQ   Sequence 954 BP; 243 A; 255 C; 265 G; 191 T; 0 other;
     gagccccaca gtcttcgtta caacctcatg gtgctgtccc aggatggatc tgtgcagtca        60
     gggtttctcg ctgagggaca tctggatggt cagcccttcc tgcgctatga caggcagaaa       120
     cgcagggcaa agccccaggg acagtgggca gaaaatgtcc tgggagctaa gacctgggac       180
     acagagaccg aggacttgac agagaatggg caagacctca ggaggaccct gactcatatc       240
     aaggaccaga aaggaggctt gcattccctc caggagatta gggtctgtga gatccatgaa       300
     gacagcagca ccaggggctc ccggcatttc tactacgatg gggagctctt cctctcccaa       360
     aacctggaga ctcaagaatc gacagtgccc cagtcctcca gagctcagac cttggctatg       420
     aacgtcacaa atttctggaa ggaagatgcc atgaagacca agacacacta tcgcgctatg       480
     caggcagact gcctgcagaa actacagcga tatctgaaat ccggggtggc catcaggaga       540
     acagtgcccc ccatggtgaa tgtcacctgc agcgaggtct cagagggcaa catcaccgtg       600
     acatgcaggg cttccagctt ctatccccgg aatatcacac tgacctggcg tcaggatggg       660
     gtatctttga gccacaacac ccagcagtgg ggggatgtcc tgcctgatgg gaatggaacc       720
     taccagacct gggtggccac caggattcgc caaggagagg agcagaggtt cacctgctac       780
     atggaacaca gcgggaatca cggcactcac cctgtgccct ctgggaaggc gctggtgctt       840
     cagagtcaac ggacagactt tccatatgtt tctgctgcta tgccatgttt tgttattatt       900
     attattctct gtgtcccttg ttgcaagaag aaaacatcag cggcagaggg tcca             954
//


spacer
spacer