spacer

EBI Dbfetch

ID   HSU602V2   standard; DNA; HUM; 276 BP.
XX
AC   U93912;
XX
NI   g2072032
XX
DT   05-MAY-1997 (Rel. 51, Created)
DT   05-MAY-1997 (Rel. 51, Last updated, Version 1)
XX
DE   Human MHC class I antigen HLA-B gene (variant B*5602 allele), exon
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata; Vertebrata;
OC   Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo.
XX
RN   [1]
RP   1-276
RA   Steiner N.K., Lee K.W., Hurley C.K.;
RT   "Novel HLA-B alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Steiner N.K., Lee K.W., Hurley C.K.;
RT   ;
RL   Submitted (17-MAR-1997) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd.
RL   N.W., Washington, DC 20007, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /isolate="5227"
FT   CDS             join(U93911:<1..270,1..>276)
FT                   /codon_start=3
FT                   /db_xref="PID:g2072034"
FT                   /note="Allele: variant B*5602"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B"
FT   mRNA            join(U93911:<1..270,1..>276)
FT                   /note="Allele: variant B*5602"
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B"
FT   exon            1..276
FT                   /note="Allele: variant B*5602"
FT                   /number=3
FT                   /gene="HLA-B"
XX
SQ   Sequence 276 BP; 53 A; 85 C; 102 G; 36 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer