spacer

EBI Dbfetch

ID   AH005123; SV 2; linear; genomic DNA; STD; HUM; 602 BP.
XX
AC   AH005123; U91334-U91335;
XX
DT   07-JUL-2011 (Rel. 109, Created)
DT   07-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I HLA-B (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-602
RA   Chandanayingyong D., Sirikong M., Srinak D., Longta K., Rungroung E.,
RA   Bejchandra S., Juji T., Tokunaga K., Grosse-Wilde H.;
RT   "B15 alleles (B*1525)";
RL   Unpublished.
XX
RN   [2]
RP   1-602
RA   Chandanayingyong D., Sirikong M., Srinak D., Longta K., Rungroung E.,
RA   Bejchandra S., Juji T., Tokunaga K., Grosse-Wilde H.;
RT   ;
RL   Submitted (26-FEB-1997) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
CC   On or before Jul 6, 2011 this sequence version replaced gi:1906675,
CC   gi:1906676, gi:1906677.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..602
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="THAI DCH023"
FT                   /cell_type="lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            1..602
FT                   /gene="HLA-B"
FT   CDS             join(<1..243,344..>602)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B"
FT                   /note="Allele: HLA-B*1525"
FT                   /db_xref="GOA:O19777"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19777"
FT                   /protein_id="AAB50418.1"
FT                   /translation="AMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQE
FT                   GPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYD
FT                   QSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLE
FT                   NGK"
FT   exon            1..243
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="similar to exon 2 of B*1501"
FT   gap             244..343
FT                   /estimated_length=unknown
FT   exon            344..602
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="Allele: HLA-B*1525; similar to exon 3 of B*1502"
XX
SQ   Sequence 602 BP; 103 A; 155 C; 180 G; 64 T; 100 other;
     ccgccatgtc ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg        60
     acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc gaggatggcg ccccgggcgc       120
     catggataga gcaggagggg ccggagtatt gggaccggga gacacagatc tccaagacca       180
     acacacagac ttaccgagag agcctgcgga acctgcgcgg ctactacaac cagagcgagg       240
     ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtctca catcatccag       360
     aggatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     ga                                                                      602
//


spacer
spacer