spacer

EBI Dbfetch

ID   AH005119; SV 2; linear; genomic DNA; STD; HUM; 617 BP.
XX
AC   AH005119; U90611-U90612;
XX
DT   07-JUL-2011 (Rel. 109, Created)
DT   07-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I HLA-B (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-617
RA   Chandanayingyong D., Sirikong M., Longta K., Srinak D., Siriboonrit U.,
RA   Rungroung E., Bejchandra S.;
RT   "B*51V alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-617
RA   Chandanayingyong D., Sirikong M., Longta K., Srinak D., Siriboonrit U.,
RA   Rungroung E., Bejchandra S.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
CC   On or before Jul 6, 2011 this sequence version replaced gi:1905865,
CC   gi:1905866, gi:1905867.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..617
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="(b)HLA-A2,B77,Cw8N,DR12(DR52),DQ7/(c)A11.1,
FT                   B51V,Cw14,DR12(DR52),DQ1"
FT                   /cell_line="THAI DCH010"
FT                   /cell_type="lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            1..617
FT                   /gene="HLA-B"
FT   CDS             join(<1..250,351..>617)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B"
FT                   /note="Allele: HLA-B*51V"
FT                   /db_xref="GOA:O19771"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19771"
FT                   /protein_id="AAB50151.1"
FT                   /translation="FYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWI
FT                   EQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGPDGRLLR
FT                   GHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRR
FT                   HLENGKETL"
FT   exon            1..250
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B"
FT                   /number=2
FT                   /note="Allele: HLA-B*51V; similar to exon 2 of B*5105"
FT   gap             251..350
FT                   /estimated_length=unknown
FT   exon            351..617
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B"
FT                   /number=3
FT                   /note="Allele: HLA-B*51V; similar to exon 3 of B*5101"
XX
SQ   Sequence 617 BP; 110 A; 163 C; 177 G; 67 T; 100 other;
     ttctacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac        60
     gtggacgaca cccagttcgt gaggttcgac agcgacgccg cgagtccgag gacggagccc       120
     cgggcgccat ggatagagca ggaggggccg gagtattggg accggaacac acagatcttc       180
     aagaccaaca cacagactta ccgagagaac ctgcggatcg cgctccgcta ctacaaccag       240
     agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggtctcacac       360
     ttggcagacg atgtatggct gcgacgtggg gccggacggg cgcctcctcc gcgggcataa       420
     ccagtacgcc tacgacggca aagattacat cgccctgaac gaggacctga gctcctggac       480
     cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga       540
     gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagac acctggagaa       600
     cgggaaggag acgctgc                                                      617
//


spacer
spacer