Dbfetch

ID   U90563; SV 1; linear; genomic DNA; STD; HUM; 982 BP.
XX
AC   U90563;
XX
DT   17-JAN-1998 (Rel. 54, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I antigen HLA-B heavy chain (HLA-B*3502 allele)
DE   gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-982
RX   DOI; 10.1007/s002510050307.
RX   PUBMED; 9321426.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Perez-Blas M.,
RA   Granados J., Layrisse Z., Montoya F., Varela P., Arnaiz-Villena A.;
RT   "Generation of the HLA-B35, -B5, -B16, and B15 groups of alleles studied by
RT   intron 1 and 2 sequence analysis";
RL   Immunogenetics 46(6):469-476(1997).
XX
RN   [2]
RP   1-982
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; 08322a3ede98227b9dcfc948c8d31aaf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..982
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..62,192..461,707..>982)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT   exon            <1..62
FT                   /gene="HLA-B"
FT                   /number=1
FT   CDS             join(<1..62,192..461,707..>982)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT                   /note="Allele: B*3502; HLA class I heavy chain"
FT                   /db_xref="GOA:O78050"
FT                   /db_xref="IMGT/HLA:B*35:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O78050"
FT                   /protein_id="AAB96790.1"
FT                   /translation="APRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFIAV
FT                   GYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGY
FT                   YNQSEAGSHIIQRMYGCDLGPDGRFLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQIT
FT                   QRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
FT   intron          63..191
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            192..461
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          462..706
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            707..>982
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 982 BP; 168 A; 322 C; 364 G; 128 T; 0 other;
     ggcgccccga accgtcctcc tgctgctctg gggggcagtg gccctgaccg agacctgggc        60
     cggtgagtgc ggggtcggga gggaaatggc ctctgtgggg aggagcgagg ggaccgcagg       120
     cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc tcagcccctc       180
     ctcgccccca ggctcccact ccatgaggta tttctacacc gccatgtccc ggcccggccg       240
     cggggagccc cgcttcatcg cagtgggcta cgtggacgac acccagttcg tgaggttcga       300
     cagcgacgcc gcgagtccga ggacggagcc ccgggcgcca tggatagagc aggaggggcc       360
     ggagtattgg gaccggaaca cacagatctt caagaccaac acacagactt accgagagag       420
     cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac cccggcccgg       480
     ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga gtctccgggt       540
     ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg cgagagcccc       600
     aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg ttggtcgggg       660
     cggggcgggg ctcgggggac ggggctgacc gcggggccgg ggccagggtc tcacatcatc       720
     cagaggatgt atggctgcga cctggggccc gacgggcgct tcctccgcgg gcataaccag       780
     tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg       840
     gcggacaccg cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag       900
     ctgagagcct acctggaggg cctgtgcgtg gagtggctcc gcagatacct ggagaacggg       960
     aaggagacgc tgcagcgcgc gg                                                982
//