Dbfetch

ID   U90562; SV 1; linear; genomic DNA; STD; HUM; 953 BP.
XX
AC   U90562;
XX
DT   17-NOV-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen HLA-B heavy chain (HLA-B*4501 allele)
DE   gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-953
RX   DOI; 10.1034/j.1399-0039.1999.530205.x.
RX   PUBMED; 10090615.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Granados J.,
RA   Varela P., Alegre R., Longas J., Gonzalez-Hevilla M., Martin-Villa J.M.,
RA   Arnaiz-Villena A.;
RT   "Evolutionary relationships between HLA-B alleles as indicated by an
RT   analysis of intron sequences";
RL   Tissue Antigens 53(2):153-160(1999).
XX
RN   [2]
RP   1-953
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; 328b7cf284dfd8ff6cae39ac96403ad6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..953
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..29,158..427,678..>953)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT   exon            <1..29
FT                   /gene="HLA-B"
FT                   /number=1
FT   CDS             join(<1..29,158..427,678..>953)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT                   /note="Allele: B*4501; HLA class I heavy chain"
FT                   /db_xref="GOA:Q9TP44"
FT                   /db_xref="IMGT/HLA:B*45:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP44"
FT                   /protein_id="AAF08608.1"
FT                   /translation="ALALTETWAGSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRF
FT                   DSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTW
FT                   QRMYGCDLGPDGRLLRGYNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAE
FT                   QDRAYLEGLCVESLRRYLENGKETLQRA"
FT   intron          30..157
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            158..427
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          428..677
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            678..>953
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 953 BP; 164 A; 312 C; 357 G; 120 T; 0 other;
     ggccctggcc ctgaccgaga cctgggccgg tgagtgcggg tcggcaggga aatggcctct        60
     gtggggagga gcgaggggac cgcaggcggg ggcgcaggac ccggggagcc gcgccgggag       120
     gagggtcggg cgggtctcag cccctcctcg cccccaggct cccactccat gaggtatttc       180
     cacaccgcca tgtcccggcc cggccgcggg gagccccgct tcatcaccgt gggctacgtg       240
     gacgacacgc tgttcgtgag gttcgacagc gacgccacga gtccgaggaa ggagccgcgg       300
     gcgccatgga tagagcagga ggggccggag tattgggacc gggagacaca gatctccaag       360
     accaacacac agacttaccg agagagcctg cggaacctgc gcggctacta caaccagagc       420
     gaggccggtg agtgaccccg gcccggggcg caggtcacga ctccccatcc cccacgtacg       480
     gcccgggtcg ccccgagtct ccgggtccga gatccgcccc cctgaggccg cgggacccgc       540
     ccagaccctc gaccggcgag agccccaggc gcgtttaccc ggtttcattt tcagttgagg       600
     ccaaaatccc cgcgggttgg tcggggcggg gcggggcggg gctcggggga cggggctgac       660
     cgcggggcct gggccagggt ctcacacttg gcagaggatg tatggctgcg acctggggcc       720
     cgacgggcgc ctcctccgcg ggtataacca gttagcctac gacggcaagg attacatcgc       780
     cctgaacgag gacctgagct cctggaccgc ggcggacacc gcggctcaga tcacccagcg       840
     caagtgggag gcggcccgtg tggcggagca ggacagagcc tacctggagg gcctgtgcgt       900
     ggagtcgctc cgcagatacc tggagaacgg gaaggagacg ctgcagcgcg cgg              953
//