spacer

EBI Dbfetch

ID   U90561; SV 2; linear; genomic DNA; STD; HUM; 947 BP.
XX
AC   U90561;
XX
DT   17-NOV-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen HLA-B heavy chain (HLA-B*44031 allele)
DE   gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-947
RX   DOI; 10.1034/j.1399-0039.1999.530205.x.
RX   PUBMED; 10090615.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Granados J.,
RA   Varela P., Alegre R., Longas J., Gonzalez-Hevilla M., Martin-Villa J.M.,
RA   Arnaiz-Villena A.;
RT   "Evolutionary relationships between HLA-B alleles as indicated by an
RT   analysis of intron sequences";
RL   Tissue Antigens 53(2):153-160(1999).
XX
RN   [2]
RP   1-947
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid 28041,
RL   Spain
XX
RN   [3]
RC   Sequence update by submitter
RP   1-947
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (26-NOV-1999) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; 4904311c7840b5b86ff35ef4685bd9dd.
XX
CC   On Nov 26, 1999 this sequence version replaced gi:6446408.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..947
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..29,159..428,672..>947)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT   exon            <1..29
FT                   /gene="HLA-B"
FT                   /number=1
FT   CDS             join(<1..29,159..428,672..>947)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT                   /note="Allele: B*44031; HLA class I heavy chain"
FT                   /db_xref="GOA:Q9TP45"
FT                   /db_xref="IMGT/HLA:B*44:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP45"
FT                   /protein_id="AAF08607.2"
FT                   /translation="ALALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRF
FT                   DSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHII
FT                   QRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAE
FT                   QLRAYLEGLCVESLRRYLENGKETLQRA"
FT   intron          30..158
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            159..428
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          429..671
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            672..>947
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 947 BP; 164 A; 311 C; 355 G; 117 T; 0 other;
     ggccctggcc ctgaccgaga cctgggccgg tgagtgcggg gtcgggaggg aaatggcctc        60
     tgtggggagg agagagggga ccgcaggcgg gggcgcagga cccggggagc cgcgccggga       120
     ggagggtcgg gcgggtctca gcccctcctc gcccccaggc tcccactcca tgaggtattt       180
     ctacaccgcc atgtcccggc ccggccgcgg ggagccccgc ttcatcaccg tgggctacgt       240
     ggacgacacg ctgttcgtga ggttcgacag cgacgccacg agtccgagga aggagccgcg       300
     ggcgccatgg atagagcagg aggggccgga gtattgggac cgggagacac agatctccaa       360
     gaccaacaca cagacttacc gagagaacct gcgcaccgcg ctccgctact acaaccagag       420
     cgaggccggt gagtgacccc ggcccggggc gcaggtcacg actccccatc ccccacgtac       480
     ggcccgggtc gccccgagtc tccgggtccg agatccgccc ccgaggccgc gggacccgcc       540
     cagaccctcg accggcgaga gccccaggcg cgtttacccg gtttcatttt cagttgaggc       600
     caaaatcccc gcgggttggt cggggcgggg cggggctcgg gggacggggc tgaccgcggg       660
     gccggggcca gggtctcaca tcatccagag gatgtacggc tgcgacgtgg ggccggacgg       720
     gcgcctcctc cgcgggtatg accaggacgc ctacgacggc aaggattaca tcgccctgaa       780
     cgaggacctg agctcctgga ccgcggcgga caccgcggct cagatcaccc agcgcaagtg       840
     ggaggcggcc cgtgtggcgg agcagctgag agcctacctg gagggcctgt gcgtggagtc       900
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcgcgg                     947
//


spacer
spacer