Dbfetch

ID   U90560; SV 2; linear; genomic DNA; STD; HUM; 949 BP.
XX
AC   U90560;
XX
DT   17-NOV-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen HLA-B heavy chain (HLA-B*4101 allele)
DE   gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-949
RX   DOI; 10.1034/j.1399-0039.1999.530205.x.
RX   PUBMED; 10090615.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Granados J.,
RA   Varela P., Alegre R., Longas J., Gonzalez-Hevilla M., Martin-Villa J.M.,
RA   Arnaiz-Villena A.;
RT   "Evolutionary relationships between HLA-B alleles as indicated by an
RT   analysis of intron sequences";
RL   Tissue Antigens 53(2):153-160(1999).
XX
RN   [2]
RP   1-949
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid 28041,
RL   Spain
XX
RN   [3]
RC   Sequence update by submitter
RP   1-949
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (26-NOV-1999) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; b5bb0c645215bef06ad199cdee2cb6b4.
XX
CC   On Nov 26, 1999 this sequence version replaced gi:6446406.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..949
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..29,158..427,674..>949)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT   exon            <1..29
FT                   /gene="HLA-B"
FT                   /number=1
FT   CDS             join(<1..29,158..427,674..>949)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT                   /note="Allele: B*4101; HLA class I heavy chain"
FT                   /db_xref="IMGT/HLA:B*41:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP46"
FT                   /protein_id="AAF08606.1"
FT                   /translation="ALALTETWAGSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRF
FT                   DSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTW
FT                   QRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAE
FT                   QDRAYLEGTCVEWLRRYLENGKDTLERA"
FT   intron          30..157
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            158..427
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          428..673
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            674..>949
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 949 BP; 164 A; 309 C; 358 G; 118 T; 0 other;
     ggccctggcc ctgaccgaga cctgggccgg tgagtgcggg tcggcaggga aatggcctct        60
     gtggggagga gcgaggggac cgcaggcggg ggcgcaggac ccggggagcc gcgccgggag       120
     gagggtcggg cgggtctcag ctcctcctcg cccccaggct cccactccat gaggtatttc       180
     cacaccgcca tgtcccggcc cggccgcggg gagccccgct tcatcaccgt gggctacgtg       240
     gacgacacgc tgttcgtgag gttcgacagc gacgccacga gtccgaggaa ggagccgcgg       300
     gcgccatgga tagagcagga ggggccggag tattgggacc gggagacaca gatctccaag       360
     accaacacac agacttaccg agagagcctg cggaacctgc gcggctacta caaccagagc       420
     gaggccggtg agtgaccccg gcccggggcg caggtcacga ctccccatcc cccacggacg       480
     gcccgggtcg ccccgagtct ccgggtccga gatccgcctc cctgaggccg cgggacccgc       540
     ccagaccctc gaccggcgag agccccaggc gcgtttaccc ggtttcattt tcagttgagg       600
     ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg gggggacggg gctgaccgcg       660
     gggcctgggc cagggtctca cacttggcag aggatgtatg gctgcgacgt ggggccggac       720
     gggcgcctcc tccgcgggca taaccagtac gcctacgacg gcaaggatta catcgccctg       780
     aacgaggacc tgcgctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag       840
     tgggaggcgg cccgtgtggc ggagcaggac agagcctacc tggagggcac gtgcgtggag       900
     tggctccgca gatacctgga gaacgggaag gacacgctgg agcgcgcgg                   949
//