spacer

EBI Dbfetch

ID   U90559; SV 1; linear; genomic DNA; STD; HUM; 949 BP.
XX
AC   U90559;
XX
DT   17-NOV-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen HLA-B heavy chain (HLA-B*1801 allele)
DE   gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-949
RX   DOI; 10.1034/j.1399-0039.1999.530205.x.
RX   PUBMED; 10090615.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Granados J.,
RA   Varela P., Alegre R., Longas J., Gonzalez-Hevilla M., Martin-Villa J.M.,
RA   Arnaiz-Villena A.;
RT   "Evolutionary relationships between HLA-B alleles as indicated by an
RT   analysis of intron sequences";
RL   Tissue Antigens 53(2):153-160(1999).
XX
RN   [2]
RP   1-949
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; 3ca69a0e11384cca330d8bfb4353e8d8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..949
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..29,158..427,674..>949)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT   exon            <1..29
FT                   /gene="HLA-B"
FT                   /number=1
FT   CDS             join(<1..29,158..427,674..>949)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT                   /note="Allele: B*1801; HLA class I heavy chain"
FT                   /db_xref="GOA:Q9TP47"
FT                   /db_xref="IMGT/HLA:B*18:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP47"
FT                   /protein_id="AAF08605.1"
FT                   /translation="ALALTETWAGSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRF
FT                   DSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTL
FT                   QRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAE
FT                   QLRAYLEGTCVEWLRRHLENGKETLQRA"
FT   intron          30..157
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            158..427
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          428..673
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            674..>949
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 949 BP; 160 A; 316 C; 357 G; 116 T; 0 other;
     ggccctggcc ctgaccgaga cctgggccgg tgagtgcggg gtcgggaggg aaatggcctc        60
     tgtggggagg agcgagggga ccgcaggcgg gggcgcagga cccggggagc cgcgccggga       120
     ggagggtcgg gcgggtctca gcccctcctt gccccaggct cccactccat gaggtatttc       180
     cacacctccg tgtcccggcc cggccgcggg gagccccgct tcatctcagt gggctacgtg       240
     gacggcaccc agttcgtgag gttcgacagc gacgccgcga gtccgaggac ggagccccgg       300
     gcgccgtgga tagagcaaga ggggccggag tattgggacc ggaacacaca gatctccaag       360
     accaacacac agacttaccg agagagcctg cggaacctgc gcggctacta caaccagagc       420
     gaggccggtg agtgaccccg gcccggggcg caggtcacga ctccccatcc cccacgtacg       480
     gcccgggtcg ccccgagtct ccgggtccga gatccgcccc cctgaggccg cgggacccgc       540
     ccagaccctc gaccggcgag agccccaggc gcgtttaccc ggtttcattt tcagttgagg       600
     ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg gggggacggg gctgaccgcg       660
     gggccggggc cagggtctca caccctccag aggatgtacg gctgcgacgt ggggccggac       720
     gggcgcctcc tccgcgggca tgaccagtcc gcctacgacg gcaaggatta catcgccctg       780
     aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag       840
     tgggaggcgg cccgtgtggc ggagcagctg agagcctacc tggagggcac gtgcgtggag       900
     tggctccgca gacacctgga gaacgggaag gagacgctgc agcgcgcgg                   949
//


spacer
spacer