Dbfetch

ID   U90558; SV 1; linear; genomic DNA; STD; HUM; 949 BP.
XX
AC   U90558;
XX
DT   17-NOV-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen HLA-B heavy chain (HLA-B*1402 allele)
DE   gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-949
RX   DOI; 10.1034/j.1399-0039.1999.530205.x.
RX   PUBMED; 10090615.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Granados J.,
RA   Varela P., Alegre R., Longas J., Gonzalez-Hevilla M., Martin-Villa J.M.,
RA   Arnaiz-Villena A.;
RT   "Evolutionary relationships between HLA-B alleles as indicated by an
RT   analysis of intron sequences";
RL   Tissue Antigens 53(2):153-160(1999).
XX
RN   [2]
RP   1-949
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (25-FEB-1997) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; ea000a8758cc3b44467420f0022a0785.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..949
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..29,158..427,674..>949)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT   exon            <1..29
FT                   /gene="HLA-B"
FT                   /number=1
FT   CDS             join(<1..29,158..427,674..>949)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B heavy chain"
FT                   /note="Allele: B*1402; HLA class I heavy chain"
FT                   /db_xref="GOA:Q9TP48"
FT                   /db_xref="IMGT/HLA:B*14:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP48"
FT                   /protein_id="AAF08604.1"
FT                   /translation="ALALTETWAGSHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRF
FT                   DSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTL
FT                   QWMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAE
FT                   QLRAYLEGTCVEWLRRHLENGKETLQRA"
FT   intron          30..157
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            158..427
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          428..673
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            674..>949
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 949 BP; 164 A; 308 C; 359 G; 118 T; 0 other;
     ggccctggcc ctgaccgaga cctgggccgg tgagtgcggg tcgggaggga aatggcctct        60
     gccgggagga gcgaggggac cgcaggcggg ggcgcaggac ctgaggagcc gcgccgggag       120
     gagggtcggg cgggtttcag cccctcctcg cccccaggct cccactccat gaggtatttc       180
     tacaccgccg tgtcccggcc cggccgcggg gagccccgct tcatctcagt gggctacgtg       240
     gacgacacgc agttcgtgag gttcgacagc gacgccgcga gtccgagaga ggagccgcgg       300
     gcgccgtgga tagagcagga ggggccggaa tattgggacc ggaacacaca gatctgcaag       360
     accaacacac agactgaccg agagagcctg cggaacctgc gcggctacta caaccagagc       420
     gaggccggtg agtgaccccg gcccggggcg caggtcacga ctccccatcc cccacggacg       480
     gcccgggtcg ccccgagtct ccgggtccga gatccgcctc cctgaggccg cgggacccgc       540
     ccagaccctc gaccggcgag agccccaggc gcgtttaccc ggtttcattt tcagttgagg       600
     ccaaaatccc cgcgggttgg gcggggcggg gcggggctcg gggggactgg gctgaccgcg       660
     ggggcggggc cagggtctca caccctccag tggatgtatg gctgcgacgt ggggccggac       720
     gggcgcctcc tccgcgggta taaccagttc gcctacgacg gcaaggatta catcgccctg       780
     aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag       840
     tgggaggcgg cccgtgaggc ggagcagctg agagcctacc tggagggcac gtgcgtggag       900
     tggctccgca gacacctgga gaacgggaag gagacgctgc agcgcgcgg                   949
//