spacer

EBI Dbfetch

ID   AH005115; SV 2; linear; genomic DNA; STD; HUM; 617 BP.
XX
AC   AH005115; U90422-U90423;
XX
DT   07-JUL-2011 (Rel. 109, Created)
DT   07-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I HLA-B (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-617
RA   Chandanayingyong D., Sirikong M., Longta K., Srinak D., Rungroung E.,
RA   Bejchandra S., Blasczyk R., Grosse-Wilde H.;
RT   "B15 alleles (B*1513)";
RL   Unpublished.
XX
RN   [2]
RP   1-617
RA   Chandanayingyong D., Sirikong M., Longta K., Srinak D., Rungroung E.,
RA   Bejchandra S., Blasczyk R., Grosse-Wilde H.;
RT   ;
RL   Submitted (23-FEB-1997) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
CC   On or before Jul 6, 2011 this sequence version replaced gi:1905834,
CC   gi:1905835, gi:1905836.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..617
FT                   /organism="Homo sapiens"
FT                   /chromosome="VI"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="THAI DCH011"
FT                   /cell_type="lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            1..617
FT                   /gene="HLA-B"
FT   CDS             join(<1..250,351..>617)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B"
FT                   /db_xref="GOA:O19774"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19774"
FT                   /protein_id="AAB50145.1"
FT                   /translation="FYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWI
FT                   EQEGPEYWDRNTQISKTNTQTYRENLRIALRYYNQSEAGSHIIQRMYGCDVGPDGRLLR
FT                   GYDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRR
FT                   YLENGKETL"
FT   exon            1..250
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B"
FT                   /number=2
FT                   /note="Allele: HLA-B*1513"
FT   gap             251..350
FT                   /estimated_length=unknown
FT   exon            351..617
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B"
FT                   /number=3
FT                   /note="Allele: HLA-B*1513"
XX
SQ   Sequence 617 BP; 107 A; 162 C; 179 G; 69 T; 100 other;
     ttctacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac        60
     gtggacgaca cccagttcgt gaggttcgac agcgacgccg cgagtccgag gatggcgccc       120
     cgggcgccat ggatagagca ggaggggccg gagtattggg accggaacac acagatctcc       180
     aagaccaaca cacagactta ccgagagaac ctgcggatcg cgctccgcta ctacaaccag       240
     agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggtctcacat       360
     catccagagg atgtatggct gcgacgtggg gccggacggg cgcctcctcc gcgggtatga       420
     ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctga gctcctggac       480
     cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga       540
     gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat acctggagaa       600
     cgggaaggag acgctgc                                                      617
//


spacer
spacer