spacer

EBI Dbfetch

ID   U88252; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   U88252;
XX
DT   06-MAR-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Human MHC class I HLA-C gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Chopek M., Cao K., Zhang G.H.;
RT   ;
RL   Submitted (04-FEB-1997) to the INSDC.
RL   National Histocompatibility Lab, American Red Cross, 22 S. Greene St, Box
RL   173, Baltimore, MD 21201, USA
XX
DR   MD5; 326f9ca17996b9ce001d3430b2af34e4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="rn183C"
FT                   /db_xref="taxon:9606"
FT   exon            1..276
FT                   /number=3
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /product="MHC class I HLA-C"
FT                   /db_xref="GOA:P79618"
FT                   /db_xref="IMGT/HLA:C*16:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:P79618"
FT                   /protein_id="AAB48496.1"
FT                   /translation="SHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAARAAEQWRAYLEGTCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 50 A; 88 C; 102 G; 36 T; 0 other;
     ggtctcacac cctccagtgg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgcggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer