spacer

EBI Dbfetch

ID   U88251; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   U88251;
XX
DT   06-MAR-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Human MHC class I HLA-C gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Chopek M., Cao K., Zhang G.H.;
RT   ;
RL   Submitted (04-FEB-1997) to the INSDC.
RL   National Histocompatibility Lab, American Red Cross, 22 S. Greene St, Box
RL   173, Baltimore, MD 21201, USA
XX
DR   MD5; e0e4271c485c1dfff27da3ae661b4b28.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="rn126C"
FT                   /db_xref="taxon:9606"
FT   exon            1..276
FT                   /number=3
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /product="MHC class I HLA-C"
FT                   /db_xref="GOA:P79617"
FT                   /db_xref="IMGT/HLA:C*04:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:P79617"
FT                   /protein_id="AAB48495.1"
FT                   /translation="SHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 52 A; 85 C; 101 G; 38 T; 0 other;
     ggtctcacac cctccagagg atgtttggct gcgacctggg gccggacggg cgcctcctcc        60
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggatctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer