spacer

EBI Dbfetch

ID   U88249; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   U88249;
XX
DT   06-MAR-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Human MHC class I HLA-B gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Chopek M., Cao K., Zhang G.H.;
RT   ;
RL   Submitted (04-FEB-1997) to the INSDC.
RL   National Histocompatibility Lab, American Red Cross, 22 S. Greene St, Box
RL   173, Baltimore, MD 21201, USA
XX
DR   MD5; 89094fce173bf915fbda56f341a9474b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="71B"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /product="MHC class I HLA-B"
FT                   /db_xref="GOA:P79615"
FT                   /db_xref="IMGT/HLA:B*42:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:P79615"
FT                   /protein_id="AAB48493.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 57 A; 87 C; 91 G; 35 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer