spacer

EBI Dbfetch

ID   U88244; SV 1; linear; mRNA; STD; HUM; 1023 BP.
XX
AC   U88244;
XX
DT   22-JUL-1999 (Rel. 60, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC-G (HLA) mRNA, HLA-G*01012 allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1023
RX   DOI; 10.1046/j.1365-2370.1998.00102.x.
RX   PUBMED; 9777333.
RA   Castro M.J., Morales P., Catalfamo M., Fernandez-Soria V., Suarez B.,
RA   Varela P., Perez-Blas M., Alvarez M., Jaraquemada D., Arnaiz-Villena A.;
RT   "Lack of HLA-G soluble isoforms in Graves-Basedow thyrocytes and complete
RT   cDNA sequence of the HLA-G*01012 allele";
RL   Eur. J. Immunogenet. 25(4):311-315(1998).
XX
RN   [2]
RP   1-1023
RA   Castro M., Morales P., Arnaiz-Villena A.;
RT   ;
RL   Submitted (04-FEB-1997) to the INSDC.
RL   Hospital Universitario 12 De Octubre, Inmunologia, Ctra. De Andalucia,
RL   Madrid 28041, Spain
XX
DR   MD5; 1176e7448a0430d2977218f77b0232da.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
DR   H-InvDB; HIT000222071_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1023
FT                   /organism="Homo sapiens"
FT                   /isolate="4510.G1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..916
FT                   /codon_start=2
FT                   /gene="HLA"
FT                   /product="MHC-G"
FT                   /note="HOSA-G1"
FT                   /db_xref="GOA:Q9UM45"
FT                   /db_xref="H-InvDB:HIT000222071_03.4"
FT                   /db_xref="IMGT/HLA:G*01:01:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UM45"
FT                   /protein_id="AAD45397.1"
FT                   /translation="AVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQE
FT                   GPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYE
FT                   QYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLE
FT                   NGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVE
FT                   TRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGL
FT                   VVLAAVVTGAAVAAVLWRKKSSD"
XX
SQ   Sequence 1023 BP; 212 A; 289 C; 341 G; 181 T; 0 other;
     cgccgtgtcc cggcccggcc gcggggagcc ccgcttcatc gccatgggct acgtggacga        60
     cacgcagttc gtgcggttcg acagcgactc ggcgtgtccg aggatggagc cgcgggcgcc       120
     gtgggtggag caggaggggc cagagtattg ggaagaggag acacggaaca ccaaggccca       180
     cgcacagact gacagaatga acctgcagac cctgcgcggc tactacaacc agagcgaggc       240
     cagttctcat accctccagt ggatgattgg ctgcgacctg gggtccgacg gacgcctcct       300
     ccgcgggtat gaacagtatg cctacgatgg caaggattac ctcgccctga acgaggacct       360
     gcgctcctgg accgcagcgg acactgcggc tcagatctcc aagcgcaagt gtgaggcggc       420
     caatgtggct gaacaaagga gagcctacct ggagggcacg tgcgtggagt ggctccacag       480
     atacctggag aacgggaagg agatgctgca gcgcgcggac ccccccaaga cacacgtgac       540
     ccaccaccct gtctttgact atgaggccac cctgaggtgc tgggccctgg gcttctaccc       600
     tgcggagatc atactgacct ggcagcggga tggggaggac cagacccagg acgtggagct       660
     cgtggagacc aggcctgcag gggatggaac cttccagaag tgggcagctg tggtggtgcc       720
     ttctggagag gagcagagat acacgtgcca tgtgcagcat gaggggctgc cggagcccct       780
     catgctgaga tggaagcagt cttccctgcc caccatcccc atcatgggta tcgttgctgg       840
     tctggttgtc cttgcagctg tagtcactgg agctgcggtc gctgctgtgc tgtggaggaa       900
     gaagagctca gattgaaaag gagggagcta ctctcaggct gcaatgtgaa acagctgccc       960
     tgtgtgggac tgagtggcaa gatttgttca tgccttccct ttgtgacttc aagaaccctg      1020
     act                                                                    1023
//


spacer
spacer