Dbfetch

ID   U88134; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   U88134;
XX
DT   27-FEB-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class II antigen (HLA-DR) gene, allele DRB1*1331, exon 2 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RX   DOI; 10.1034/j.1399-0039.2000.550121.x.
RX   PUBMED; 10703621.
RA   Lin Y.S., Hoyer R.J., Tang T.F., Ng J., Hartzmann R.J., Hurley C.K.;
RT   "Detection of four novel alleles: DRB1*1130, DRB1*13072, DRB1*1315 and
RT   DRB1*1331";
RL   Tissue Antigens 55(1):92-96(2000).
XX
RN   [2]
RP   1-269
RA   Hurley C.K., Tang T.F., Lin Y.S.;
RT   ;
RL   Submitted (03-FEB-1997) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd, NW,
RL   Washington, D.C. 20007, USA
XX
DR   MD5; 07a3be72eee764a4b8d72796a45e30c2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="GN00138"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*1301, 1331; DRB3*0202, 0301.
FT                   DQB1*0602,0502; DQA1*0102, 0103"
FT                   /tissue_type="whole blood"
FT                   /note="African American"
FT                   /db_xref="taxon:9606"
FT   exon            1..269
FT                   /gene="HLA-DR"
FT                   /number=2
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DR"
FT                   /product="MHC class II antigen"
FT                   /note="allele: DRB1*1331"
FT                   /db_xref="GOA:P79605"
FT                   /db_xref="IMGT/HLA:DRB1*13:31"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:P79605"
FT                   /protein_id="AAB52242.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPVAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 269 BP; 57 A; 66 C; 96 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcga                                         269
//