spacer

EBI Dbfetch

ID   U88133; SV 1; linear; genomic DNA; STD; HUM; 268 BP.
XX
AC   U88133;
XX
DT   27-FEB-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class II antigen (HLA-DR) gene, allele DRB1*1331, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-268
RX   DOI; 10.1034/j.1399-0039.2000.550121.x.
RX   PUBMED; 10703621.
RA   Lin Y.S., Hoyer R.J., Tang T.F., Ng J., Hartzmann R.J., Hurley C.K.;
RT   "Detection of four novel alleles: DRB1*1130, DRB1*13072, DRB1*1315 and
RT   DRB1*1331";
RL   Tissue Antigens 55(1):92-96(2000).
XX
RN   [2]
RP   1-268
RA   Hurley C.K., Tang T.F., Lin Y.S.;
RT   ;
RL   Submitted (03-FEB-1997) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd, NW,
RL   Washington, D.C. 20007, USA
XX
DR   MD5; a0460db713cdb04a9e8a2736b52bc6ee.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..268
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="GN00133"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A2, A30; B44, B58; Bw4; Cw4. DRB1*1102, 1331;
FT                   DRB3*0202, 0301. DQB1*0301, 0502; DQA1*05AC, 0102"
FT                   /tissue_type="whole blood"
FT                   /note="African American"
FT                   /db_xref="taxon:9606"
FT   exon            1..268
FT                   /gene="HLA-DR"
FT                   /number=2
FT   CDS             <1..>268
FT                   /codon_start=2
FT                   /gene="HLA-DR"
FT                   /product="MHC class II antigen"
FT                   /note="allele: DRB1*1331"
FT                   /db_xref="GOA:P79604"
FT                   /db_xref="IMGT/HLA:DRB1*13:31"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:P79604"
FT                   /protein_id="AAB52241.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPVAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 268 BP; 57 A; 65 C; 96 G; 50 T; 0 other;
     acgtttcttg gagtactcta cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg        60
     gttcctggac agatacttcc ataaccagga ggagaacgtg cgcttcgaca gcgacgtggg       120
     ggagttccgg gcggtgacgg agctggggcg gcctgtcgcc gagtactgga acagccagaa       180
     ggacatcctg gaagacgagc gggccgcggt ggacacctac tgcagacaca actacggggt       240
     tggtgagagc ttcacagtgc agcggcga                                          268
//


spacer
spacer