spacer

EBI Dbfetch

ID   U83583; SV 1; linear; mRNA; STD; HUM; 799 BP.
XX
AC   U83583;
XX
DT   04-JUL-1997 (Rel. 52, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II antigen HLA-DR mRNA (HLA-DRB1*1301 allele),
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-799
RA   White J.M., Baxter-Lowe L.A.;
RT   ;
RL   Submitted (03-JAN-1997) to the INSDC.
RL   Molecular Genetics, Richland Memorial Hospital-CCTR, 7 Richland Medical
RL   Park, Columbia, SC 29203-6897, USA
XX
DR   MD5; b8bcb8745d8c9e69ae23941554809e20.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..799
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..675
FT                   /codon_start=1
FT                   /gene="HLA-DR"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:O19762"
FT                   /db_xref="IMGT/HLA:DRB1*13:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19762"
FT                   /protein_id="AAC02812.1"
FT                   /translation="ECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVC
FT                   SVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVE
FT                   HPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGF
FT                   LS"
XX
SQ   Sequence 799 BP; 181 A; 199 C; 249 G; 170 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttccataac        60
     caggaggaga acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgccgagta ctggaacagc cagaaggaca tcctggaaga cgagcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttgtgg agagcttcac agtgcagcgg       240
     cgagtccatc ctaaggtgac tgtgtatcct tcaaagaccc agcccctgca gcaccacaac       300
     ctcctggtct gttctgtgag tggtttctat ccaggcagca ttgaagtcag gtggttccgg       360
     aatggccagg aagagaagac tggggtggtg tccacaggcc tgatccacaa tggagactgg       420
     accttccaga ccctggtgat gctggaaaca gttcctcgga gtggagaggt ttacacctgc       480
     caagtggagc acccaagcgt gacaagccct ctcacagtgg aatggagagc acggtctgaa       540
     tctgcacaga gcaagatgct gagtggagtc gggggctttg tgctgggcct gctcttcctt       600
     ggggccgggc tgttcatcta cttcaggaat cagaaaggac actctggact tcagccaaga       660
     ggattcctga gctgaagtgc agatgacaca ttcaaagaag aactttctgc cccagctttg       720
     caggatgaaa agctttccct cctggctgtt attcttccac aagagagggc tttctcagga       780
     cctggttgct actggttcg                                                    799
//


spacer
spacer