spacer

EBI Dbfetch

ID   U83582; SV 1; linear; mRNA; STD; HUM; 870 BP.
XX
AC   U83582;
XX
DT   29-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA-DQ mRNA (HLA-DQB1*0301 allele), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-870
RA   White J.M., Baxter-Lowe LA.;
RT   ;
RL   Submitted (31-DEC-1996) to the INSDC.
RL   Molecular Genetics, Richland Memorial Hospital-CCTR, 7 Richland Medical
RL   Park, Columbia, SC 29203-6897, USA
XX
DR   MD5; ba380b03a87567996585e760a9bd7d20.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..870
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..784
FT                   /codon_start=2
FT                   /gene="HLA-DQ"
FT                   /product="MHC class II HLA-DQ"
FT                   /note="DQB1*0301 allele"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="H-InvDB:HIT000221829_03.4"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*03:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAB41231.1"
FT                   /translation="SWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAM
FT                   CYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRA
FT                   ELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWF
FT                   RNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQ
FT                   SESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH"
XX
SQ   Sequence 870 BP; 187 A; 252 C; 252 G; 179 T; 0 other;
     gtcttggaaa aaggctttgc ggatccccgg aggccttcgg gcagcaactg ttaccttgat        60
     gctggcgatg ctgagcaccc cagtggctga gggcagagac tctcccgagg atttcgtgta       120
     ccagtttaag gccatgtgct acttcaccaa cgggacggag cgcgtgcgtt atgtgaccag       180
     atacatctat aaccgagagg agtacgcacg cttcgacagc gacgtggagg tgtaccgggc       240
     ggtgacgccg ctggggccgc ctgacgccga gtactggaac agccagaagg aagtcctgga       300
     gaggacccgg gcggagttgg acacggtgtg cagacacaac taccagttgg agctccgcac       360
     gaccttgcag cggcgagtgg agcccacagt gaccatctcc ccatccagga cagaggccct       420
     caaccaccac aacctgctgg tctgctcagt gacagatttc tatccagccc agatcaaagt       480
     ccggtggttt cggaatgacc aggaggagac aaccggcgtt gtgtccaccc cccttattag       540
     gaacggtgac tggaccttcc agatcctggt gatgctggaa atgactcccc agcatggaga       600
     cgtctacacc tgccacgtgg agcaccccag cctccagaac cccatcaccg tggagtggcg       660
     ggctcagtct gaatctgccc agagcaagat gctgagtggc attggaggct tcgtgctggg       720
     gctcatcttc ctcgggctgg gccttattat ccatcacagg agtcagaaag ggctcctgca       780
     ctgactcctg agactatttt aactgggatt ggttatcact tttctgtaac gcctgcttgt       840
     ccctgcccag aattcccaac tgcctgtgtc                                        870
//


spacer
spacer