spacer

EBI Dbfetch

ID   U83581; SV 1; linear; genomic DNA; STD; HUM; 497 BP.
XX
AC   U83581;
XX
DT   29-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human cell line DCH027 MHC class I HLA-B gene (allele HLA-B*1532), partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-497
RA   Chandanayingyong D., Sirikong M., Srinak D., Longta K., Rungroung E.,
RA   Bejchandra S., Juji T., Tokunaga K.;
RT   "B15 alleles (B*1532)";
RL   Unpublished.
XX
RN   [2]
RP   1-497
RA   Chandanayingyong D., Sirikong M., Srinak D., Longta K., Rungroung E.,
RA   Bejchandra S., Juji T., Tokunaga K.;
RT   ;
RL   Submitted (27-DEC-1996) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
DR   MD5; e3c94a3b6ef846dd6606c812fa230c6e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..497
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DCH027"
FT                   /cell_type="lymphoblastoid cell"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>497
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B"
FT                   /note="allele: HLA-B*1532"
FT                   /db_xref="GOA:P79666"
FT                   /db_xref="IMGT/HLA:B*15:32:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:P79666"
FT                   /protein_id="AAB49761.1"
FT                   /translation="FYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWI
FT                   EQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMSGCDVGPDGRLLR
FT                   GHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRR
FT                   YL"
XX
SQ   Sequence 497 BP; 98 A; 159 C; 175 G; 65 T; 0 other;
     ttctacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac        60
     gtggacgaca cccagttcgt gaggttcgac agcgacgccg cgagtccgag gatggcgccc       120
     cgggcgccat ggatagagca ggaggggccg gagtattggg accgggagac acagatctcc       180
     aagaccaaca cacagactta ccgagagagc ctgcggaacc tgcgcggcta ctacaaccag       240
     agcgaggccg ggtctcacac cctccagagg atgtctggct gcgacgtggg gccggacggg       300
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       360
     gaggacctga gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg       420
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg       480
     ctccgcagat acctgga                                                      497
//


spacer
spacer