spacer

EBI Dbfetch

ID   U83415; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   U83415;
XX
DT   03-JUN-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I antigen HLA-A (HLA-A*2901 allele) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1007/BF02341610.
RX   PUBMED; 2461903.
RA   Trapani J.A., Mizuno S., Kang S.H., Yang S.Y., Dupont B.;
RT   "Molecular mapping of a new public HLA class I epitope shared by all HLA-B
RT   and HLA-C antigens and defined by a monoclonal antibody";
RL   Immunogenetics 29(1):25-32(1989).
XX
RN   [2]
RP   1-1098
RA   Szmania S., Baxter-Lowe L.A.;
RT   "Corrected nucleotide sequences of HLA-A*2901 and HLA-A*3301";
RL   Unpublished.
XX
RN   [3]
RP   1-1098
RA   Szmania S., Baxter-Lowe L.A.;
RT   ;
RL   Submitted (30-DEC-1996) to the INSDC.
RL   Molecular Genetics, Richland Memorial Hospital, Seven Richland Medical
RL   Park, Columbia, SC 29203, USA
XX
DR   MD5; dc69eba77203748f1bb3f8c5bf4ba466.
DR   Ensembl-Gn; ENSG00000231834; homo_sapiens.
DR   Ensembl-Tr; ENST00000456012; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="mRNA"
FT                   /cell_line="Epstein-Barr transformed cell line"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P30512"
FT                   /db_xref="H-InvDB:HIT000221823.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*29:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30512"
FT                   /protein_id="AAB53373.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCHVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   misc_difference 909
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="correction to previously published sequence"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 1034..1035
FT                   /gene="HLA-A"
FT                   /replace="tc"
FT                   /note="correction to previously published sequence"
FT                   /note="conflict"
FT                   /citation=[1]
XX
SQ   Sequence 1098 BP; 214 A; 327 C; 370 G; 187 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttcacca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttt       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcac cgtggataga gcaggagggg       240
     ccggagtatt gggacctgca gacacggaat gtgaaggccc agtcacagac tgaccgagcg       300
     aacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     atgatgtatg gctgccacgt ggggtcggac gggcgcttcc tccgcgggta ccggcaggac       420
     gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cgcccccaag acgcatatga ctcaccacgc tgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctagttct ctttggagct       960
     gtgttcgctg gagctgtggt cgctgctgtg aggtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tatgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer