spacer

EBI Dbfetch

ID   U77589; SV 1; linear; mRNA; STD; HUM; 768 BP.
XX
AC   U77589;
XX
DT   03-APR-1997 (Rel. 51, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II HLA-DQ-alpha chain (HLA-DQA1) mRNA, HLA-DQA1*0104
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-768
RX   DOI; 10.1111/j.1399-0039.1997.tb02883.x.
RX   PUBMED; 9349615.
RA   Lardy N.M., Otting N., van der Horst A.R., Bontrop R.E., de Waal L.P.;
RT   "Full-length cDNA nucleotide sequence of a serologically undetectable
RT   HLA-DQA1 allele: HLA-DQA1*"LA"";
RL   Tissue Antigens 50(4):334-339(1997).
XX
RN   [2]
RP   1-768
RA   Lardy N.M., Horst A.R., Otting N., Bontrop R.E., Waal de L.P.;
RT   ;
RL   Submitted (06-NOV-1996) to the INSDC.
RL   Central Lab of the Dutch Red Cross Blood Transfusion Service, Plesmanlaan
RL   125, Amsterdam 1066CX, The Netherlands
XX
DR   MD5; 527a4b051874efa4f167098c321deb54.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..768
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="I-2"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-A2, B7, DR14, DQ'blanc'"
FT                   /cell_line="EBV"
FT                   /tissue_type="PBL"
FT                   /db_xref="taxon:9606"
FT   CDS             1..768
FT                   /codon_start=1
FT                   /gene="HLA-DQA1"
FT                   /product="MHC class II HLA-DQ-alpha chain"
FT                   /function="binds to T cell receptor"
FT                   /db_xref="GOA:O19760"
FT                   /db_xref="H-InvDB:HIT000221378.15"
FT                   /db_xref="IMGT/HLA:DQA1*01:07"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19760"
FT                   /protein_id="AAB51233.1"
FT                   /translation="MILNKALLLGALALTTMMSPCGGEGIVADHVASCGVNLYQFYGPS
FT                   GQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKCYN
FT                   STAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSF
FT                   LSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCT
FT                   LGLSVGLVGIVVGTVFIIQGLRSVGASRHQGPL"
XX
SQ   Sequence 768 BP; 166 A; 200 C; 203 G; 199 T; 0 other;
     atgatcctaa acaaagctct gctgctgggg gccctcgctc tgaccaccat gatgagccct        60
     tgtggaggtg aaggcattgt ggctgaccac gttgcctctt gtggtgtaaa cttgtaccag       120
     ttttacggtc cctctggcca gtacacccat gaatttgatg gagatgagga gttctacgtg       180
     gacctggaga ggaaggagac tgcctggcgg tggcctgagt tcagcaaatt tggaggtttt       240
     gacccgcagg gtgcactgag aaacatggct gtggcaaaac acaacttgaa catcatgatt       300
     aaatgctaca actctaccgc tgctaccaat gaggttcctg aggtcacagt gttttccaag       360
     tctcccgtga cactgggtca gcccaacacc ctcatttgtc ttgtggacaa catctttcct       420
     cctgtggtca acatcacatg gctgagcaat gggcagtcag tcacagaagg tgtttctgag       480
     accagcttcc tctccaagag tgatcattcc ttcttcaaga tcagttacct caccttcctc       540
     ccttctgctg atgagattta tgactgcaag gtggagcact ggggcctgga ccagcctctt       600
     ctgaaacact gggagcctga gattccagcc cctatgtcag agctcacaga gactgtggtc       660
     tgcaccctgg ggttgtctgt gggcctcgtg ggcattgtgg tgggcactgt cttcatcatc       720
     caaggcctgc gttcagttgg tgcttccaga caccaagggc cattgtga                    768
//


spacer
spacer