spacer

EBI Dbfetch

ID   AH005893; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH005893; U76216-U76217;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens class I histocompatibility antigen (HLA-G) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1073/pnas.84.24.9145.
RX   PUBMED; 3480534.
RA   Geraghty D.E., Koller B.H., Orr H.T.;
RT   "A human major histocompatibility complex class I gene that encodes a
RT   protein with a shortened cytoplasmic segment";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(24):9145-9149(1987).
XX
RN   [2]
RP   1-646
RA   Ober C., Rosinsky B., Grimsley C., Robertson A., Runge A.;
RT   ;
RL   Submitted (25-OCT-1996) to the INSDC.
RL   Ob/Gyn, Univ. of Chicago, 924 East 57th Street, Chicago, IL 60637, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-646
RA   Ober C., Rosinsky B., Grimsley C., Robertson A., Runge A.;
RT   ;
RL   Submitted (23-FEB-1998) to the INSDC.
RL   Ob/Gyn, Univ. of Chicago, 924 East 57th Street, Chicago, IL 60637, USA
XX
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Gn; ENSG00000264751; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
DR   Ensembl-Tr; ENST00000582523; homo_sapiens.
DR   Ensembl-Tr; ENST00000583373; homo_sapiens.
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:2905824, gi:1685130, gi:2905825.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-G"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /product="class I histocompatibility antigen"
FT                   /db_xref="GOA:Q7JFN0"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7JFN0"
FT                   /protein_id="AAC03714.1"
FT                   /translation="GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRM
FT                   EPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLG
FT                   SDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGT
FT                   CVEWLHRYLENGKEMLQRA"
FT   exon            1..270
FT                   /gene="HLA-G"
FT                   /number=2
FT                   /note="alpha1 domain"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-G"
FT                   /number=3
FT                   /note="alpha2 domain"
XX
SQ   Sequence 646 BP; 114 A; 164 C; 188 G; 80 T; 100 other;
     ggctcccact ccatgaggta tttcagcgcc gccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatcg ccatgggcta cgtggacgac acgcagttcg tgcggttcga cagcgactcg       120
     gcgtgtccga ggatggagcc gcgggcgccg tgggtggagc aggaggggcc ggagtattgg       180
     gaagaggaga cacggaacac caaggcccac gcacagactg acagaatgaa cctgcagacc       240
     ctgcgcggct actacaacca gagcgaggcc nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn agttctcaca ccctccagtg gatgattggc tgcgacctgg ggtccgacgg       420
     acgcctcctc cgcgggtatg aacagtatgc ctacgatggc aaggattacc tcgccctgaa       480
     cgaggacctg cgctcctgga ccgcagcgga cactgcggct cagatctcca agcgcaagtg       540
     tgaggcggcc aatgtggctg aacaaaggag agcctacctg gagggcacgt gcgtggagtg       600
     gctccacaga tacctggaga acgggaagga gatgctgcag cgcgcg                      646
//


spacer
spacer