spacer

EBI Dbfetch

ID   U75865; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   U75865;
XX
DT   23-AUG-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens MHC class I antigen HLA-B gene, exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1007/s002510050286.
RX   PUBMED; 9218543.
RA   Vargas-Alarcon G., Gomez-Casado E., Martinez-Laso J., Granados J.,
RA   de la Torre C.G., Alegre R., Alcocer-Varela J., Arnaiz-Villena A.;
RT   "Description of a new HLA-B40 allele (B*4011) found in a Mexican individual
RT   of Nahua (Aztec) descent";
RL   Immunogenetics 46(4):359-360(1997).
XX
RN   [2]
RP   1-276
RX   DOI; 10.1034/j.1399-0039.1999.530205.x.
RX   PUBMED; 10090615.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Granados J.,
RA   Varela P., Alegre R., Longas J., Gonzalez-Hevilla M., Martin-Villa J.M.,
RA   Arnaiz-Villena A.;
RT   "Evolutionary relationships between HLA-B alleles as indicated by an
RT   analysis of intron sequences";
RL   Tissue Antigens 53(2):153-160(1999).
XX
RN   [3]
RP   1-276
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (23-OCT-1996) to the INSDC.
RL   Hospital 12 De Octubre, Inmunologia, Carretera De Andalucia, Madrid, Spain,
RL   28041
XX
RN   [4]
RC   Nucleotide sequence updated by submitter
RP   1-276
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (04-AUG-1998) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid, Spain
RL   28041
XX
DR   MD5; 64565241214fc0ab09af8d88bc482f1b.
XX
CC   On Aug 4, 1998 this sequence version replaced gi:2341081.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(U75864.1:<1..270,1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="HLA-B"
FT                   /db_xref="GOA:O19793"
FT                   /db_xref="IMGT/HLA:B*40:11:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19793"
FT                   /protein_id="AAC29503.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 276 BP; 53 A; 86 C; 103 G; 34 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer