Dbfetch

ID   AH006343; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH006343; U75864-U75865;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   29-JUL-2016 (Rel. 129, Last updated, Version 2)
XX
DE   Homo sapiens chromosome 6 HLA-B (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1007/s002510050286.
RX   PUBMED; 9218543.
RA   Vargas-Alarcon G., Gomez-Casado E., Martinez-Laso J., Granados J.,
RA   de la Torre C.G., Alegre R., Alcocer-Varela J., Arnaiz-Villena A.;
RT   "Description of a new HLA-B40 allele (B*4011) found in a Mexican individual
RT   of Nahua (Aztec) descent";
RL   Immunogenetics 46(4):359-360(1997).
XX
RN   [2]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.1999.530205.x.
RX   PUBMED; 10090615.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Granados J.,
RA   Varela P., Alegre R., Longas J., Gonzalez-Hevilla M., Martin-Villa J.M.,
RA   Arnaiz-Villena A.;
RT   "Evolutionary relationships between HLA-B alleles as indicated by an
RT   analysis of intron sequences";
RL   Tissue Antigens 53(2):153-160(1999).
XX
RN   [3]
RP   1-646
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (23-OCT-1996) to the INSDC.
RL   Hospital 12 De Octubre, Inmunologia, Carretera De Andalucia, Madrid, Spain,
RL   28041
XX
RN   [4]
RC   Nucleotide sequence updated by submitter
RP   371-646
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (04-AUG-1998) to the INSDC.
RL   Inmunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid, Spain
RL   28041
XX
DR   MD5; d48a72ef8952e4b7f26aa88d540ff10e.
XX
CC   On or before Apr 6, 2016 this sequence version replaced gi:2341080,
CC   gi:3386347, gi:3386348.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>646
FT                   /gene="HLA-B"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="HLA-B"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:O19793"
FT                   /protein_id="AAC29503.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 173 C; 191 G; 70 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//