spacer

EBI Dbfetch

ID   U74387; SV 1; linear; mRNA; STD; HUM; 677 BP.
XX
AC   U74387;
XX
DT   04-FEB-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class I antigen HLA-B (HLA-B*3911 allele) mRNA, exons 2-4,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-677
RA   Eberle M., Iwanaga K.K., Kolman C., Watkins D.I.;
RT   "Further diversification of the HLA-B locus alleles in South American
RT   Amerindians: a new B39 allele in the Kuna of Panama";
RL   Unpublished.
XX
RN   [2]
RP   1-677
RA   Eberle M., Iwanaga K.K., Kolman C., Watkins D.I.;
RT   ;
RL   Submitted (15-OCT-1996) to the INSDC.
RL   Wisconsin Regional Primate Research Center, University of
RL   Wisconsin-Madison, 1220 Capitol Court, Madison, WI 53715, USA
XX
DR   MD5; 71655a1d920f8e4d62d5c59abc84d30a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..677
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..677
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3911"
FT   CDS             <1..>677
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P79543"
FT                   /db_xref="H-InvDB:HIT000221242.9"
FT                   /db_xref="IMGT/HLA:B*39:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:P79543"
FT                   /protein_id="AAB41721.1"
FT                   /translation="YTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIE
FT                   QEGPEYWDRNTQICKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRG
FT                   HNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRTYLEGTCVEWLRRY
FT                   LENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTEL
FT                   VET"
XX
SQ   Sequence 677 BP; 146 A; 217 C; 228 G; 86 T; 0 other;
     tacacctccg tgtcccggcc cggccgcggg gagccccgct tcatctcagt gggctacgtg        60
     gacgacacgc agttcgtgag gttcgacagc gacgccgcga gtccgagaga ggagccgcgg       120
     gcgccgtgga tagagcagga ggggccggaa tattgggacc ggaacacaca gatctgcaag       180
     accaacacac agacttaccg agagagcctg cggaacctgc gcggctacta caaccagagc       240
     gaggccgggt ctcacaccct ccagaggatg tacggctgcg acgtggggcc ggacgggcgc       300
     ctcctccgcg ggcataacca gttcgcctac gacggcaagg attacatcgc cctgaacgag       360
     gacctgagct cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag       420
     gcggcccgtg tggcggagca gcggagaacc tacctggagg gcacgtgcgt ggagtggctc       480
     cgcagatacc tggagaacgg gaaggagacg ctgcagcgcg cggacccccc aaagacacat       540
     gtgacccacc accccatctc tgaccatgag gccaccctga ggtgctgggc cctgggcttc       600
     taccctgcgg agatcacact gacctggcag cgggatggcg aggaccaaac tcaggacacc       660
     gagcttgtgg agaccag                                                      677
//


spacer
spacer