spacer

EBI Dbfetch

ID   U73113; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   U73113;
XX
DT   04-NOV-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC cell surface glycoprotein (HLA-B*5603) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Barnardo M.C.N.M., Bunce M., Lord C.;
RT   ;
RL   Submitted (02-OCT-1996) to the INSDC.
RL   Transplantation Immunology, Oxford Transplant Centre, Churchill Hospital,
RL   Old Road, Oxford, Oxon OX3 7LJ, England
XX
DR   MD5; f5a603754335fde23384ec7910c3b395.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A*11, B*4601, B*5603, C*0102"
FT                   /cell_line="NPC-4"
FT                   /db_xref="taxon:9606"
FT   gene            1..791
FT                   /gene="HLA-B*5603"
FT   exon            1..270
FT                   /gene="HLA-B*5603"
FT                   /number=2
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B*5603"
FT                   /product="MHC cell surface glycoprotein"
FT                   /db_xref="GOA:Q95390"
FT                   /db_xref="IMGT/HLA:B*56:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95390"
FT                   /protein_id="AAB18131.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   intron          271..514
FT                   /gene="HLA-B*5603"
FT                   /number=2
FT   exon            515..791
FT                   /gene="HLA-B*5603"
FT                   /number=3
XX
SQ   Sequence 791 BP; 141 A; 262 C; 287 G; 101 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcctggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccctgagg ccgcgggacc cgcccaaacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggcctgg gccagggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt ggagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer