spacer

EBI Dbfetch

ID   U69978; SV 1; linear; genomic DNA; STD; HUM; 1023 BP.
XX
AC   U69978;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I-like molecule PERB11.2-IMX (PERB11.2) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-1023
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-1023
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-1023
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (09-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St, Perth, WA 6001, Australia
XX
DR   MD5; 8baabcf5780ef15280d04e1ae55e069e.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; U69978.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1023
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="unknown MHC haplotype"
FT                   /cell_type="fibrobalst"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>1023
FT                   /codon_start=1
FT                   /gene="PERB11.2"
FT                   /product="MHC class I-like molecule PERB11.2-IMX"
FT                   /note="PERB11 gene family; lacking cytoplasmic tail"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*003"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="AAB51802.1"
FT                   /translation="MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGF
FT                   LAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIK
FT                   DQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAM
FT                   NVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVICSEVSEGNIT
FT                   VTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFT
FT                   CYMEHSGNHGTHPVPSGKALVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEG
FT                   P"
XX
SQ   Sequence 1023 BP; 245 A; 281 C; 288 G; 209 T; 0 other;
     atggggctgg gccgggtcct gctgtttctg gccgtcgcct tcccttttgc acccccggca        60
     gccgccgctg agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct       120
     gtgcagtcag ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac       180
     aggcagaaac gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctaag       240
     acctgggaca cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg       300
     actcatatca aggaccagaa aggaggcttg cattccctcc aggagattag ggtctgtgag       360
     atccatgaag acagcagcac caggggctcc cggcatttct actacgatgg ggagctcttc       420
     ctctcccaaa acctggagac tcaagaatcg acagtgcccc agtcctccag agctcagacc       480
     ttggctatga acgtcacaaa tttctggaag gaagatgcca tgaagaccaa gacacactat       540
     cgcgctatgc aggcagactg cctgcagaaa ctacagcgat atctgaaatc cggggtggcc       600
     atcaggagaa cagtgccccc catggtgaat gtcatctgca gcgaggtctc agagggcaac       660
     atcaccgtga catgcagggc ttccagcttc tatccccgga atatcacact gacctggcgt       720
     caggatgggg tatctttgag ccacaacacc cagcagtggg gggatgtcct gcctgatggg       780
     aatggaacct accagacctg ggtggccacc aggattcgcc aaggagagga gcagaggttc       840
     acctgctaca tggaacacag cgggaatcac ggcactcacc ctgtgccctc tgggaaggcg       900
     ctggtgcttc agagtcaacg gacagacttt ccatatgttt ctgctgctat gccatgtttt       960
     gttattatta ttattctctg tgtcccttgt tgcaagaaga aaacatcagc ggcagagggt      1020
     cca                                                                    1023
//


spacer
spacer