spacer

EBI Dbfetch

ID   U69975; SV 1; linear; genomic DNA; STD; HUM; 300 BP.
XX
AC   U69975;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I-like molecule PERB11.1-65.1 (PERB11.1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-300
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-300
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-300
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (09-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St, Perth, WA 6001, Australia
XX
DR   MD5; b34ea9f99dc3a849ba012fb963c19166.
DR   IMGT/LIGM; U69975.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..300
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /strain="R86-12364 (AOH-100002N)"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="65.1 MHC ancestral haplotype (R86-12364:
FT                   HLA-A33; Cw802; -B65; DRB1*0102; DQA1*0101; DQB1*0501)"
FT                   /db_xref="taxon:9606"
FT   intron          1..148
FT   exon            149..286
FT                   /gene="PERB11.1"
FT   CDS             <149..>286
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="MHC class I-like molecule PERB11.1-65.1"
FT                   /note="PERB11 gene family; transmembrane region"
FT                   /db_xref="IMGT/HLA:MICA*011"
FT                   /db_xref="UniProtKB/TrEMBL:P79538"
FT                   /protein_id="AAB51799.1"
FT                   /translation="GKVLVLQSHWQTFHVSAVAAAAAAIFVIIIFYVCCCKKKTSAAEG
FT                   P"
FT   intron          287..300
XX
SQ   Sequence 300 BP; 65 A; 61 C; 88 G; 86 T; 0 other;
     tgctacatgg aacacagcgg gaatcacagc actcacgctg tgccctctgg tgagcctagg        60
     gtgacgctgg agagggtcag accagggtag ggacagcagg gatggctgtg gctctctgcc       120
     cagtgtataa caagtccctt ttttttcagg gaaagtgctg gtgcttcaga gtcattggca       180
     gacattccat gtttctgctg ttgctgctgc tgctgctgct atttttgtta ttattatttt       240
     ctatgtctgt tgttgtaaga agaaaacatc agctgcagag ggtccaggtg agaaaagggt       300
//


spacer
spacer