spacer

EBI Dbfetch

ID   U69974; SV 1; linear; genomic DNA; STD; HUM; 295 BP.
XX
AC   U69974;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I-like molecule PERB11.1-62.1 (PERB11.1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-295
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-295
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-295
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (09-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St, Perth, WA 6001, Australia
XX
DR   MD5; 58d31853a0235f09e42c9277e0602fd3.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000417943; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000420259; homo_sapiens.
DR   Ensembl-Tr; ENST00000432479; homo_sapiens.
DR   IMGT/LIGM; U69974.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..295
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /strain="R86-12316 (AOH-100072Q)"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="62.1 MHC ancestral haplotype (R86-12316:
FT                   HLA-A2.2; Cw10; -B62.3; C4A3; C4B1; DRB1*0401; DRB4*0101;
FT                   DQA1*0300; DQB1*0302)"
FT                   /db_xref="taxon:9606"
FT   intron          1..147
FT   exon            148..282
FT                   /gene="PERB11.1"
FT   CDS             <148..>282
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="MHC class I-like molecule PERB11.1-62.1"
FT                   /note="PERB11 gene family; transmembrane region"
FT                   /db_xref="IMGT/HLA:MICA*010:01"
FT                   /db_xref="UniProtKB/TrEMBL:P79537"
FT                   /protein_id="AAB51798.1"
FT                   /translation="GKVLVLQSHWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGP
FT                   "
FT   intron          283..295
XX
SQ   Sequence 295 BP; 64 A; 63 C; 86 G; 82 T; 0 other;
     tgctacatgg aacacagcgg gaatcacagc actcaccctg tgccctctgg tgagcctagg        60
     gtgaccctgg agagggtcag gccagggtag ggacagcagg gatggctgtg gctctctgcc       120
     cagtgtataa caagtccctt tttttcaggg aaagtgctgg tgcttcagag tcattggcag       180
     acattccatg tttctgctgt tgctgctgct gctgctattt ttgttattat tattttctat       240
     gtccgttgtt gtaagaagaa aacatcagct gcagagggtc caggtgagaa aaggg            295
//


spacer
spacer