spacer

EBI Dbfetch

ID   U69972; SV 1; linear; genomic DNA; STD; HUM; 293 BP.
XX
AC   U69972;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I-like molecule PERB11.1-54.1 (PERB11.1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-293
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-293
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-293
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (09-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St, Perth, WA 6001, Australia
XX
DR   MD5; 1f173edbdda898b5ffb91ce330adc8ea.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Tr; ENST00000400322; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000436191; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; U69972.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..293
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /strain="R88-15375 (AOH-100062T)"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="54.1 MHC ancestral haplotype (R88-15373:
FT                   HLA-A24; Cw1; -B54; DRB1*0405; DRB4*0101; DQA1*0300;
FT                   DQB1*0401)"
FT                   /db_xref="taxon:9606"
FT   intron          1..148
FT   exon            149..280
FT                   /gene="PERB11.1"
FT   CDS             <149..>280
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="MHC class I-like molecule PERB11.1-54.1"
FT                   /note="PERB11 gene family; transmembrane region"
FT                   /db_xref="IMGT/HLA:MICA*012:01"
FT                   /db_xref="UniProtKB/TrEMBL:P79535"
FT                   /protein_id="AAB51796.1"
FT                   /translation="GKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   intron          281..293
XX
SQ   Sequence 293 BP; 64 A; 62 C; 85 G; 82 T; 0 other;
     tgctacatgg aacacagcgg gaatcacagc actcaccctg tgccctctgg tgagcctagg        60
     gtgaccctgg agagggtcag gccagggtag ggacagcagg gatggctgtg gctctctgcc       120
     cagtgtataa caagtccctt ttttttcagg gaaagtgctg gtgcttcaga gtcattggca       180
     gacattccat gtttctgctg ttgctgctgc tgctattttt gttattatta ttttctatgt       240
     ccgttgttgt aagaagaaaa catcagctgc agagggtcca ggtgagaaaa ggg              293
//


spacer
spacer