spacer

EBI Dbfetch

ID   U69971; SV 1; linear; genomic DNA; STD; HUM; 298 BP.
XX
AC   U69971;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I-like molecule PERB11.1-52.1 (PERB11.1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-298
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-298
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-298
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (09-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St, Perth, WA 6001, Australia
XX
DR   MD5; 575ba5db9c290fc7fd0ce5621f153286.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000417943; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000420259; homo_sapiens.
DR   Ensembl-Tr; ENST00000432479; homo_sapiens.
DR   IMGT/LIGM; U69971.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..298
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /strain="R87-4709 (AOH-100065M)"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="52.1 MHC ancestral haplotype (R87-4709:
FT                   HLA-A24; Cw6; -B52; C4A3+2; C4BQ0; DRB1*1502; DRB5*0102;
FT                   DQA1*0103; DQB1*0601)"
FT                   /db_xref="taxon:9606"
FT   intron          1..147
FT   exon            148..285
FT                   /gene="PERB11.1"
FT   CDS             <148..>285
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="MHC class I-like molecule PERB11.1-52.1"
FT                   /note="PERB11 gene family; transmembrane region"
FT                   /db_xref="IMGT/HLA:MICA*009:01"
FT                   /db_xref="UniProtKB/TrEMBL:P79534"
FT                   /protein_id="AAB51795.1"
FT                   /translation="GKVLVLQSHWQTFHVSAVAAAAAAIFVIIIFYVRCCKKKTSAAEG
FT                   P"
FT   intron          286..298
XX
SQ   Sequence 298 BP; 64 A; 64 C; 87 G; 83 T; 0 other;
     tgctacatgg aacacagcgg gaatcacagc actcaccctg tgccctctgg tgagcctagg        60
     gtgaccctgg agagggtcag gccagggtag ggacagcagg gatggctgtg gctctctgcc       120
     cagtgtataa caagtccctt tttttcaggg aaagtgctgg tgcttcagag tcattggcag       180
     acattccatg tttctgctgt tgctgctgct gctgctgcta tttttgttat tattattttc       240
     tatgtccgtt gttgtaagaa gaaaacatca gctgcagagg gtccaggtga gaaaaggg         298
//


spacer
spacer