Dbfetch

ID   U69629; SV 1; linear; genomic DNA; STD; HUM; 1214 BP.
XX
AC   U69629;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human PERB11.1 gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-1214
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-1214
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-1214
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (06-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St., Perth, WA 6001, Australia
XX
DR   MD5; 465f502d1f1eee751037a43c45f77770.
DR   IMGT/LIGM; U69629.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1214
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="R86-12316 (4AOH-100072Q)"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="62.1 MHC ancestral haplotype HLA-A2.2, Cw10,
FT                   -B62.3, -C4A3, -C4B3, -DRB1*0401, -DRB4*0101, -DQA1*0300,
FT                   -DQB1*0302"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<295..550,825..>1111)
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="PERB11.1 protein"
FT                   /note="Allele: 62.1; encodes alpha 1 and alpha 2 domains;
FT                   MHC Class I-like molecule"
FT                   /db_xref="GOA:Q99695"
FT                   /db_xref="IMGT/HLA:MICA*010:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q99695"
FT                   /protein_id="AAB51785.1"
FT                   /translation="EPHSLPYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLESSVVLRRT"
XX
SQ   Sequence 1214 BP; 275 A; 327 C; 344 G; 267 T; 1 other;
     ccctgcaggg cagcctctcc ccttggcccc tattctctta gggggcttgt ggccacccag        60
     tccttgcacc tgggctacaa gtttgccatc tttattcccc cttcttctgt tcatcagccc       120
     cctcctctat cctcccaccc tcacagtttt ctttgtatat gaaatcctcg ttcttgtccc       180
     tttgcccgtg tgcatttcct gccccaggaa ggttgggaca gcagacctgt gtgttaaaca       240
     tcaatgtgaa gttacttcca ggaagaagtt tcacctgtga tttcctcttc cccagagccc       300
     cacagtcttc cttataacct cacggtgctg tcctgggatg gatctgtgca gtcagggttt       360
     cttgctgagg tacatctgga tggtcagccc ttcctgcgct atgacaggca gaaatgcagg       420
     gcaaagcccc agggacagtg ggcagaagat gtcctgggaa ataagacatg ggacagagag       480
     accagggact tgacagggaa cggaaaggac ctcaggatga ccctggctca tatcaaggac       540
     cagaaagaag gtgagagtcg gcaggggcaa gagtgactgg agaggccttt tccagaaaag       600
     ttaggggcag agagcaggga cctgtctctt cccactggat ctggctcagg ctgggggtga       660
     ggaatggggg tcagtggaac tcagcaggga ggtgakccgg cactcagccc acacagggag       720
     gcatggagga ggcccaggga ggcgtacccc ctgggctgag ttcctcactt gggtggaaag       780
     gtgatgggtt cgggaatgga gaagtcactg ctgggtgggg gcaggcttgc attccctcca       840
     ggagattagg gtctgtgaga tccatgaaga caacagcacc aggagctccc agcatttcta       900
     ctacgatggg gagctcttcc tctcccaaaa cctggagact gaggaatgga cagtgcccca       960
     gtcctccaga gctcagacct tggccatgaa cgtcaggaat ttcttgaagg aagatgccat      1020
     gaagaccaag acacactatc acgctatgca tgcagactgc ctgcaggaac tacggcgata      1080
     tctagaatcc agcgtagtcc tgaggagaac aggtaccgac gctggccagg ggctctcctc      1140
     tccctccaat tctgctagag ttgcctcacc tcccagatgt gtccagggaa accctccctg      1200
     tgctatggat gaag                                                        1214
//