Dbfetch

ID   U69627; SV 1; linear; genomic DNA; STD; HUM; 1143 BP.
XX
AC   U69627;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human PERB11.1 gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-1143
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-1143
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-1143
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (06-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St., Perth, WA 6001, Australia
XX
DR   MD5; e921b59383589f289fba29cc1f8b6d07.
DR   IMGT/LIGM; U69627.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1143
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="R88-15375 (4AOH-100062T)"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="54.1 MHC ancestral haplotype HLA-A24, -Cw1,
FT                   -B54, -DRB1*0405, -DRB4*0101, -DQA1*0300, -DQB1*0401"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<284..539,814..>1100)
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="PERB11.1 protein"
FT                   /note="Allele: 54.1; encodes alpha 1 and alpha 2 domains;
FT                   MHC Class I-like molecule"
FT                   /db_xref="IMGT/HLA:MICA*012:01"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q99694"
FT                   /protein_id="AAB51783.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTLYHAMHAD
FT                   CLQELRRYLKSGVVLRRT"
XX
SQ   Sequence 1143 BP; 261 A; 303 C; 323 G; 255 T; 1 other;
     ctctcccctt ggcccctatt cccttagggg gcttgtggcc acccagtcct tgcacctggc        60
     ctacaagttt gccatcttca ttcccccttc ttctgttcat cagccccctc ctctatcctc       120
     ccaccctcac agttttcttt gtatatgaaa tcctcgttct tgtccctttg cctgtgtgca       180
     tttcctgcct cctcaggaag gttgggacag cagacctgtg tgttaaacat caatgtgaag       240
     ttatttccag gaagaagttt cacctgtgat ttcctcttcc ccagagcccc acagtcttcg       300
     ttataacctc acggtgctgt cctgggatgg atctgtgcag tcagggtttc tcactgaggt       360
     acatctggat ggtcagccct tcctgcgctg tgacaggcag aaatgcaggg caaagcccca       420
     gggacagtgg gcagaagatg tcctgggaaa taagacatgg gacagagaga ccagagactt       480
     gacagggaac ggaaaggacc tcaggatgac cctggctcat atcaaggacc agaaagaagg       540
     tgagagtcgg caggggcaag agtgactgga gaggcctttt ccagaaaagt taggggcaga       600
     gagcagggac ctgtctcttc ccactggatc tggctcaggc tgggggtgag gaatgggggt       660
     cagtggaact cagcagggtg gtgagccggc actcagccca cacagggagg catggaggag       720
     gaccagggag gcgtaccccc tgggctgagt tcctcacttg ggtggaaagg tgatgggttc       780
     gggaatggag aagtcactgc tgggtggggg caggcttgca ttccctccag gagattaggg       840
     tctgtgagat ccatgaagac aacagcacca ggagctccca gcatttctac tacgatgggg       900
     agctcttcct ctcccaaaac ctggagactg aggaatggac aatgccccag tcctccagag       960
     ctcagacctt ggccatgaac gtcaggaatt tcttgaagga agatgccatg aagaccaaga      1020
     cactctatca cgctatgcat gcagactgcc tgcaggaact acggcgatat ctaaaatccg      1080
     gcgtagtcct gaggagaaca ggtaccgacg ctggccaggg gmtctcctct ccctccaatt      1140
     ctg                                                                    1143
//