spacer

EBI Dbfetch

ID   U69625; SV 1; linear; genomic DNA; STD; HUM; 1200 BP.
XX
AC   U69625;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human PERB11.1 gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-1200
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-1200
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-1200
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (06-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St., Perth, WA 6001, Australia
XX
DR   MD5; be45cf74b4b6d024f267967406ce8797.
DR   Ensembl-Gn; ENSG00000204520; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231225; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233051; homo_sapiens.
DR   Ensembl-Tr; ENST00000415525; homo_sapiens.
DR   Ensembl-Tr; ENST00000427477; homo_sapiens.
DR   Ensembl-Tr; ENST00000449934; homo_sapiens.
DR   Ensembl-Tr; ENST00000546529; homo_sapiens.
DR   Ensembl-Tr; ENST00000547767; homo_sapiens.
DR   IMGT/LIGM; U69625.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1200
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="R90-7379"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="47.1 MHC ancestral haplotype HLA-A3.2, -CW6,
FT                   -B47, -C4A91, -C4BQ0, -DRB1*0700, -DRB4*0101, -DQA1*0201,
FT                   -DQB1*0201"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<281..536,811..>1097)
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="PERB11.1 protein"
FT                   /note="Allele: 47.1; encodes alpha 1 and alpha 2 domains;
FT                   MHC Class I-like molecule"
FT                   /db_xref="GOA:P78551"
FT                   /db_xref="IMGT/HLA:MICA*008:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:P78551"
FT                   /protein_id="AAB51781.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLESGVVLRRT"
XX
SQ   Sequence 1200 BP; 274 A; 321 C; 340 G; 264 T; 1 other;
     ctctcccctt ggaccctatt cccttagggg gcttgtggcc acccagtcct tgcacctggc        60
     ctacaagttt gccatcttca ttcccccttc ttctgttcat cagccccctc ctctatcctc       120
     ccaccctcac agttttcttt gtatatgaaa tcctcgttct tgtccctttg cccgtgtgca       180
     tttcctgccy caggaaggtt gggacagcag acctgtgtgt taaacatcaa tgtgaagtta       240
     cttccaggaa gaagtttcac ctgtgatttc ctcttcccca gagccccaca gtcttcgtta       300
     taacctcacg gtgctgtcct gggatggatc tgtgcagtca gggtttcttg ctgaggtaca       360
     tctggatggt cagcccttcc tgcgctatga caggcagaaa tgcagggcaa agccccaggg       420
     acagtgggca gaagatgtcc tgggaaataa gacatgggac agagagacca gggacttgac       480
     agggaacgga aaggacctca ggatgaccct ggctcatatc aaggaccaga aagaaggtga       540
     gagtcggcag gggcaagagt gactggagag gccttttcca gaaaagttag gggcagagag       600
     cagggacctg tctcttccca ctggatctgg ctcaggctgg gggtgaggaa tgggggtcag       660
     tggaactcac cagggaggtg agccggcact cagcccacac agggaggcat ggaggagggc       720
     cagggaggca taccccctgg gctgagttcc tcacttgggt ggaaaggtga tgggttcggg       780
     aatggagaag tcactgctgg gtgggggcag gcttgcattc cctccaggag attagggtct       840
     gtgagatcca tgaagacaac agcaccagga gctcccagca tttctactac gatggggagc       900
     tcttcctctc ccaaaacctg gagactgagg aatggacagt gccccagtcc tccagagctc       960
     agaccttggc catgaacgtc aggaatttct tgaaggaaga tgccatgaag accaagacac      1020
     actatcacgc tatgcatgca gactgcctgc aggaactacg gcgatatcta gaatccggcg      1080
     tagtcctgag gagaacaggt accgacgctg gccaggggct ctcctctccc tccaattctg      1140
     ctagagttgc ctcacctccc agatgtgtcc agggaaaccc tccctgtgct atggatgaag      1200
//


spacer
spacer