spacer

EBI Dbfetch

ID   U69624; SV 1; linear; genomic DNA; STD; HUM; 1179 BP.
XX
AC   U69624;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human PERB11.1 gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-1179
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-1179
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-1179
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (06-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St., Perth, WA 6001, Australia
XX
DR   MD5; c9dbd3f2e82c7e32b9efc5d5401e69d6.
DR   Ensembl-Gn; ENSG00000204520; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231225; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233051; homo_sapiens.
DR   Ensembl-Tr; ENST00000415525; homo_sapiens.
DR   Ensembl-Tr; ENST00000427477; homo_sapiens.
DR   Ensembl-Tr; ENST00000449934; homo_sapiens.
DR   Ensembl-Tr; ENST00000546529; homo_sapiens.
DR   Ensembl-Tr; ENST00000547767; homo_sapiens.
DR   IMGT/LIGM; U69624.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1179
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="R90-7379"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="44.1 MHC ancestral haplotype HLA-A2, -B44,
FT                   -C4A3+3, -C4BQ0, -DRB1-4, -DQB1-301"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<281..536,810..>1096)
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="PERB11.1 protein"
FT                   /note="Allele: 44.1; encodes alpha 1 and alpha 2 domains;
FT                   MHC Class I-like molecule"
FT                   /db_xref="GOA:P78551"
FT                   /db_xref="IMGT/HLA:MICA*008:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:P78551"
FT                   /protein_id="AAB51780.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLESGVVLRRT"
XX
SQ   Sequence 1179 BP; 269 A; 317 C; 333 G; 258 T; 2 other;
     ctctcccctt ggcccctatt cccttagggg gcttgtggcc acccagtcct tgcacctggc        60
     ctacaagttt gccatcttca ttcccccttc ttctgttcat cagccccctc ctctatcctc       120
     ccaccctcac agttttcttt gtatatgaaa tcytcgttct tgtccctttg cccgtgtgca       180
     tttcctgccc caggaaggtt gggacagcag acctgtgtgt taaacatcaa tgtgaagtta       240
     cttccaggaa gaagtttcac ctgtgatttc ctcttcccca gagccccaca gtcttcgtta       300
     taacctcacg gtgctgtcct gggatggatc tgtgcagtca gggtttcttg ctgaggtaca       360
     tctggatggt cagcccttcc tgcgctatga caggcagaaa tgcagggcaa agccccaggg       420
     acagtgggca gaagatgtcc tgggaaataa gacatgggac agagagacca gggacttgac       480
     agggaacgga aaggacctca ggatgaccct ggctcatatc aaggaccaga aagaaggtga       540
     gagtcggcag gggcaagagt gactggagag gccttttcca gaaaagttag gggcagagag       600
     cagggacctg tctcttccca ctggatctgg ctcaggctgg gggtgaggaa tggggtcagt       660
     ggaactcagc agggaggtga gccggcactc agcccacaca gggaggcatg gaggaggncc       720
     agggaggcat accccctggg ctgagttcct cacttgggtg gaaaggtgat gggttcggga       780
     atggagaagt cactgctggg tgggggcagg cttgcattcc ctccaggaga ttagggtctg       840
     tgagatccat gaagacaaca gcaccaggag ctcccagcat ttctactacg atggggagct       900
     cttcctctcc caaaacctgg agactgagga atggacagtg ccccagtcct ccagagctca       960
     gaccttggcc atgaacgtca ggaatttctt gaaggaagat gccatgaaga ccaagacaca      1020
     ctatcacgct atgcatgcag actgcctgca ggaactacgg cgatatctag aatccggcgt      1080
     agtcctgagg agaacaggta ccgacgctgg ccaggggctc tcctctccct ccaattctgc      1140
     tagagttgcc tcacctccca gatgtgtcca gggaaaccc                             1179
//


spacer
spacer