spacer

EBI Dbfetch

ID   U69623; SV 1; linear; genomic DNA; STD; HUM; 1184 BP.
XX
AC   U69623;
XX
DT   08-JAN-1997 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human PERB11.1 gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Immunogenetics 1995;41(2-3):174]
RP   1-1184
RX   DOI; 10.1007/BF01246675.
RX   PUBMED; 7927538.
RA   Leelayuwat C., Townend D.C., Degli-Esposti M.A., Abraham L.J.,
RA   Dawkins R.L.;
RT   "A new polymorphic and multicopy MHC gene family related to nonmammalian
RT   class I";
RL   Immunogenetics 40(5):339-351(1994).
XX
RN   [2]
RP   1-1184
RX   DOI; 10.1007/s002510050191.
RX   PUBMED; 8995188.
RA   Gaudieri S., Leelayuwat C., Townend D.C., Mullberg J., Cosman D.,
RA   Dawkins R.L.;
RT   "Allelic and interlocus comparison of the PERB11 multigene family in the
RT   MHC";
RL   Immunogenetics 45(3):209-216(1997).
XX
RN   [3]
RP   1-1184
RA   Gaudieri S., Leelayuwat C., Townend D.C., Jurgen M., Cosman D.,
RA   Dawkins R.L.;
RT   ;
RL   Submitted (06-SEP-1996) to the INSDC.
RL   CMII, UWA, Wellington St., Perth, WA 6001, Australia
XX
DR   MD5; 00742ec581768ad4a76dec36cfcea5fa.
DR   IMGT/LIGM; U69623.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1184
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Q85-8086"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="35.1 MHC ancestral haplotype HLA-A1, -B35,
FT                   -C4A3, -C4B1, -DRB1-5"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<265..520,795..>1081)
FT                   /codon_start=1
FT                   /gene="PERB11.1"
FT                   /product="PERB11.1 protein"
FT                   /note="Allele: 35.1; encodes alpha 1 and alpha 2 domains;
FT                   MHC Class I-like molecule"
FT                   /db_xref="GOA:Q7JFP0"
FT                   /db_xref="IMGT/HLA:MICA*016"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q7JFP0"
FT                   /protein_id="AAB51779.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLESSVVLRRT"
XX
SQ   Sequence 1184 BP; 273 A; 311 C; 340 G; 260 T; 0 other;
     ctattccctt agggggcttg tggccaccag tccttgcacc tggcctacaa gtttgccatc        60
     ttcattcccc cttcttctgt tcatcagccc cctcctctat cctcccaccg tcacagtttt       120
     ctttgtatat gaaatcctcg ttcttgtccc tttgcccgtg tgcatttcct gccccaggaa       180
     ggttgggaca gcagacctgt gtgttaaaca tcaatgtgaa gttacttcca ggaagaagtt       240
     tcacctgtga tttcctcttc cccagagccc cacagtcttc gttataacct cacggtgctg       300
     tcctgggatg gatctgtgca gtcagggttt cttgctgagg tacatctgga tggtcagccc       360
     ttcctgcgct atgacaggca gaaatgcagg gcaaagcccc agggacagtg ggcagaagat       420
     gtcctgggaa ataagacatg ggacagagag accagggact tgacagggaa cggaaaggac       480
     ctcaggatga ccctggctca tatcaaggac cagaaagaag gtgagagtcg gcaggggcaa       540
     gagtgactgg agaggccttt tccagaaaag ttaggggcag agagcaggga cctgtctctt       600
     cccactggat ctggctcagg ctgggggtga ggaatggggg tcagtggaac tcagcaggga       660
     ggtgagccgg cactcagccc acacagggag gcatggagga gggccaggga ggcgtacccc       720
     ctgggctgag ttcctcactt gggtggaaag gtgatgggtt cgggaatgga gaagtcactg       780
     ctgggtgggg gcaggcttgc attccctcca ggagattagg gtctgtgaga tccatgaaga       840
     caacagcacc aggagctccc agcatttcta ctacgatggg gagctcttcc tctcccaaaa       900
     cctggagact gaggaatgga cagtgcccca gtcctccaga gctcagacct tggccatgaa       960
     cgtcaggaat ttcttgaagg aagatgccat gaagaccaag acacactatc acgctatgca      1020
     tgcagactgc ctgcaggaac tacggcgata tctagaatcc agcgtagtcc tgaggagaac      1080
     aggtaccgac gctggccagg ggctctcctc tccctccaat tctgctagag ttgcctcacc      1140
     tcccagatgt gtccagggaa accctccctg tgctatggat gaag                       1184
//


spacer
spacer