spacer

EBI Dbfetch

ID   AH003646; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH003646; U67746-U67747;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.1998.tb03029.x.
RX   PUBMED; 9714480.
RA   Hurley C.K., Steiner N., Kosman C., Mitton W., Koester R., Bei M., Bush J.,
RA   McCormack J., Hahn A., Henson V., Hoyer R., Wade J.A., Hartzman R.J.,
RA   Ng J.;
RT   "Novel HLA-A and HLA-B alleles";
RL   Tissue Antigens 52(1):84-87(1998).
XX
RN   [2]
RP   1-646
RA   Hurley C.K., Steiner N.K.;
RT   ;
RL   Submitted (21-AUG-1996) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd. NW,
RL   Washington, DC 20007, USA
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:1526959, gi:1526960, gi:1526961.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="B*5102/B*5602 variant"
FT                   /cell_type="PBL"
FT                   /db_xref="taxon:9606"
FT   gene            1..646
FT                   /gene="HLA-B"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /number=3
FT                   /note="01094-B*5602 variant"
FT                   /db_xref="GOA:Q95378"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95378"
FT                   /protein_id="AAB07699.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="01094-B*5602 variant"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="01094-B*5602 variant"
XX
SQ   Sequence 646 BP; 110 A; 171 C; 197 G; 68 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer