spacer

EBI Dbfetch

ID   U66826; SV 1; linear; mRNA; STD; HUM; 853 BP.
XX
AC   U66826;
XX
DT   16-JUL-1999 (Rel. 60, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*09012 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-853
RX   DOI; 10.1046/j.1365-2370.1998.00105.x.
RX   PUBMED; 9777332.
RA   Martinez-Quiles N., Martin-Villa J.M., Ferre-Lopez S., Moreno-Pelayo M.A.,
RA   Martinez-Laso J., Perez-Blas M., Alegre R., Arnaiz-Villena A.;
RT   "Complete cDNA sequence of the HLA-DRB1*09012 allele";
RL   Eur. J. Immunogenet. 25(4):307-309(1998).
XX
RN   [2]
RP   1-853
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (13-AUG-1996) to the INSDC.
RL   Antonio Arnaiz-Villena, Hospital 12 de Octubre, Inmunologia, Carretera de
RL   Andalucia, Madrid 28041, Spain
XX
DR   MD5; 9271c5214cb87b3ece7ce4a185023550.
DR   Ensembl-Gn; ENSG00000229074; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236884; homo_sapiens.
DR   Ensembl-Tr; ENST00000437784; homo_sapiens.
DR   Ensembl-Tr; ENST00000444645; homo_sapiens.
DR   H-InvDB; HIT000220991_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..853
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="18867 PMR"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="A11/Cw3/B51/DR9"
FT                   /dev_stage="infant"
FT                   /clone="20,38,50,52,59,74"
FT                   /cell_type="PBL"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             41..841
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9TQE0"
FT                   /db_xref="H-InvDB:HIT000220991_02.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*09:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9TQE0"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAD43829.1"
FT                   /translation="MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTQPRFLKQDKFECH
FT                   FFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPVAESWNSQKDFLERRRAEV
FT                   DTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 853 BP; 177 A; 219 C; 278 G; 179 T; 0 other;
     gcctgctgct ctggcccctg gtcctgtcct gttctccagc atggtgtgtc tgaagctccc        60
     tggaggctcc tgcatggcag ctctgacagt gacactgatg gtgctgagct ccccactggc       120
     tttggctggg gacacccaac cacgtttctt gaagcaggat aagtttgagt gtcatttctt       180
     caacgggacg gagcgggtgc ggtatctgca cagaggcatc tataaccaag aggagaacgt       240
     gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc       300
     cgagtcctgg aacagccaga aggacttcct ggagcggagg cgggccgagg tggacaccgt       360
     gtgcagacac aactacgggg ttggtgagag cttcacagtg cagaggcgag tccatcctga       420
     ggtgactgtg tatcctgcca agactcagcc cctgcagcac cacaacctcc tggtctgctc       480
     tgtgagtggt ttctatccag gcagcattga agtcaggtgg ttccggaacg gccaggaaga       540
     gaaggctggg gtggtgtcca caggcctgat ccagaatgga gactggacct tccagaccct       600
     ggtgatgctg gaaacagttc ctcggagtgg agaagtttac acctgccaag tggagcaccc       660
     aagtgtgatg agccctctca cagtggaatg gagagcacgg tctgaatctg cacagagcaa       720
     gatgctgagt ggagtcgggg gctttgtgct gggcctgctc ttccttgggg ccgggctgtt       780
     catctacttc aggaatcaga aaggacactc tggacttcag ccaacaggat tcctgagctg       840
     aagtgcagat gac                                                          853
//


spacer
spacer