spacer

EBI Dbfetch

ID   AH003642; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH003642; U65395-U65396;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   In preparation
RP   1-646
RA   Hurley C.K., Sintasath D.S.;
RT   "Human MHC Class I Antigen HLA-B*5802 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Hurley C.K., Sintasath D.S.;
RT   ;
RL   Submitted (25-JUL-1996) to the INSDC.
RL   Department of Microbiology and Immunology, Georgetown University, 3970
RL   Reservoir Rd., NW, Washington, DC 20007, USA
XX
DR   MD5; fa65b007fde7ed96ce75f1afd30d51c8.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:1513137, gi:1513138, gi:1513139.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="white blood cells"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..646
FT                   /gene="HLA-B"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="Allele: HLA-B*5802"
FT                   /db_xref="GOA:O19769"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19769"
FT                   /protein_id="AAB06739.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="Allele: HLA-B*5802"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="Allele: HLA-B*5802"
XX
SQ   Sequence 646 BP; 107 A; 173 C; 193 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     acggggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer