spacer

EBI Dbfetch

ID   U65246; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   U65246;
XX
DT   27-SEP-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human HLA-G gene, exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[[published erratum appears in J Reprod Immunol 1997
RC   Apr;33(1):89-90]]
RP   1-276
RX   DOI; 10.1016/S0165-0378(96)01000-5.
RX   PUBMED; 9023816.
RA   Ober C., Rosinsky B., Grimsley C., van der Ven K., Robertson A., Runge A.;
RT   "Population genetic studies of HLA-G: allele frequencies and linkage
RT   disequilibrium with HLA-A1";
RL   J. Reprod. Immunol. 32(2):111-123(1996).
XX
RN   [2]
RP   1-276
RA   Ober C., Rosinsky B., Grimsley C., Robertson A., Runge A.;
RT   ;
RL   Submitted (25-JUL-1996) to the INSDC.
RL   Human Genetics, University of Chicago, 924 East 57th Street, Chicago, IL
RL   60637, USA
XX
DR   MD5; c4ce1c205774e7d4c6f8da02760724f9.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Gn; ENSG00000264751; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
DR   Ensembl-Tr; ENST00000582523; homo_sapiens.
DR   Ensembl-Tr; ENST00000583373; homo_sapiens.
XX
CC   On Oct 25, 1996 this sequence version replaced gi:1563861.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(U65245.1:<1..270,1..>276)
FT                   /codon_start=1
FT                   /product="HLA-G"
FT                   /db_xref="GOA:O19768"
FT                   /db_xref="IMGT/HLA:G*01:01:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19768"
FT                   /protein_id="AAC50997.1"
FT                   /translation="GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRM
FT                   EPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLG
FT                   SDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGT
FT                   CVEWLHRYLENGKEMLQRA"
FT   exon            1..>276
FT                   /number=3
XX
SQ   Sequence 276 BP; 60 A; 78 C; 92 G; 46 T; 0 other;
     agttctcata ccctccagtg gatgattggc tgcgacctgg ggtccgacgg acgcctcctc        60
     cgcgggtatg aacagtatgc ctacgatggc aaggattacc tcgccctgaa cgaggacctg       120
     cgctcctgga ccgcagcgga cactgcggct cagatctcca agcgcaagtg tgaggcggcc       180
     aatgtggctg aacaaaggag agcctacctg gagggcacgt gcgtggagtg gctccacaga       240
     tacctggaga acgggaagga gatgctgcag cgcgcg                                 276
//


spacer
spacer