spacer

EBI Dbfetch

ID   AH006661; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH006661; U65241-U65242;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens HLA-G (HLA-G) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1016/S0165-0378(96)01000-5.
RX   PUBMED; 9023816.
RA   Ober C., Rosinsky B., Grimsley C., van der Ven K., Robertson A., Runge A.;
RT   "Population genetic studies of HLA-G: allele frequencies and linkage
RT   disequilibrium with HLA-A1";
RL   J. Reprod. Immunol. 32(2):111-123(1996).
XX
RN   [2]
RP   1-646
RA   Ober C., Rosinsky B., Grimsley C., Robertson A., Runge A.;
RT   ;
RL   Submitted (25-JUL-1996) to the INSDC.
RL   Human Genetics, University of Chicago, 924 East 57th Street, Chicago, IL
RL   60637, USA
XX
DR   MD5; 8adb9d513270d362de46701e1c95e971.
XX
CC   On or before Jun 30, 2011 this sequence version replaced
CC   gi:1563877, gi:1633637, gi:1633638.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-G"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /product="HLA-G"
FT                   /db_xref="GOA:Q95391"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95391"
FT                   /protein_id="AAC51101.1"
FT                   /translation="GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDSQFVRFDSDSACPRM
FT                   EPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLG
FT                   SDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGT
FT                   CVEWLHRYLENGKEMLQRA"
FT   exon            <1..270
FT                   /gene="HLA-G"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /gene="HLA-G"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 164 C; 188 G; 81 T; 100 other;
     ggctcccact ccatgaggta tttcagcgcc gccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatcg ccatgggcta cgtggacgac tcgcagttcg tgcggttcga cagcgactcg       120
     gcgtgtccga ggatggagcc gcgggcgccg tgggtggagc aggaggggcc ggagtattgg       180
     gaagaggaga cacggaacac caaggcccac gcacagactg acagaatgaa cctgcagacc       240
     ctgcgcggct actacaacca gagcgaggcc nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn agttctcaca ccctccagtg gatgattggc tgcgacctgg ggtccgacgg       420
     acgcctcctc cgcgggtatg aacagtatgc ctacgatggc aaggattacc tcgccctgaa       480
     cgaggacctg cgctcctgga ccgcagcgga cactgcggct cagatctcca agcgcaagtg       540
     tgaggcggcc aatgtggctg aacaaaggag agcctacctg gagggcacgt gcgtggagtg       600
     gctccacaga tacctggaga acgggaagga gatgctgcag cgcgcg                      646
//


spacer
spacer