spacer

EBI Dbfetch

ID   U63802; SV 1; linear; genomic DNA; STD; HUM; 253 BP.
XX
AC   U63802;
XX
DT   23-AUG-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC class II antigen (HLA-DRB1) gene, allele HLA-DRB1*0815, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-253
RX   DOI; 10.1111/j.1399-0039.1997.tb02793.x.
RX   PUBMED; 9174151.
RA   Trejaut J., Greville W., Duncan N., Dunckley H.;
RT   "A novel DRB1 allele (DRB1*0815) defined in an Australian Aborigine";
RL   Tissue Antigens 49(5):529-531(1997).
XX
RN   [2]
RP   1-253
RA   Trejaut J.A., Greville W.D.;
RT   ;
RL   Submitted (14-JUL-1996) to the INSDC.
RL   Tissue Typing, Red Cross BTS, 153 Clarence street, Sydney, NSW 2000,
RL   Australia
XX
DR   MD5; e6c11eb1b1ad3f240794ce32d0126194.
XX
CC   On Sep 25, 1996 this sequence version replaced gi:1498021.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..253
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>253
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95384"
FT                   /db_xref="IMGT/HLA:DRB1*08:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95384"
FT                   /protein_id="AAB08761.1"
FT                   /translation="FLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVT
FT                   ELGRPDAEHWNSQKDILEDRRALVDTYCRHNYGVGESFT"
XX
SQ   Sequence 253 BP; 56 A; 57 C; 90 G; 50 T; 0 other;
     tttcttggag tactctacgg gtgagtgtta tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tgatgcggag cactggaaca gccagaagga       180
     catcctggaa gacaggcggg ccctggtgga cacctactgc agacacaact acggggttgg       240
     tgagagcttc aca                                                          253
//


spacer
spacer