spacer

EBI Dbfetch

ID   AH007282; SV 2; linear; genomic DNA; STD; HUM; 626 BP.
XX
AC   AH007282; U59699-U59700;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I (HLA-A) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-626
RA   Bugawan T.L.;
RT   ;
RL   Submitted (31-MAY-1996) to the INSDC.
RL   Human Genetics, Roche Molecular System, 1145 Atlantic Ave, Alameda, CA
RL   94501, USA
XX
DR   MD5; 6f7bb9c397d4e7991ae7f165241e3592.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:4097412, gi:4097413, gi:4097414.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..626
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="sample KM315"
FT                   /db_xref="taxon:9606"
FT   gene            1..626
FT                   /gene="HLA-A"
FT   CDS             join(<1..270,371..>626)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I"
FT                   /db_xref="GOA:Q9TQE7"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TQE7"
FT                   /protein_id="AAD09488.1"
FT                   /translation="GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM
FT                   EPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVG
FT                   SDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGR
FT                   CVEWLRRYLENG"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..626
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 626 BP; 105 A; 158 C; 187 G; 76 T; 100 other;
     ggctcccact ccatgaggta tttctccaca tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc       120
     gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggaggggcc ggagtattgg       180
     gacgaggaga cagggaaagt gaaggcccac tcacagactg accgagagaa cctgcggatc       240
     gcgctccgct actacaacca gagcgaggcc nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggttctcaca ccctccagat gatgtttggc tgcgacgtgg ggtcggacgg       420
     gcgcttcctc cgcgggtacc accagtacgc ctacgacggc aaggattaca tcgccctgaa       480
     agaggacctg cgctcttgga ccgcggcgga catggcggct cagatcacca agcgcaagtg       540
     ggaggcggcc catgtggcgg agcagcagag agcctacctg gagggccggt gcgtggagtg       600
     gctccgcaga tacctggaga acggga                                            626
//


spacer
spacer